Idea Transcript
V-MathNet Korea [2018] [2017] [2016] [2015] [2014] [2013] [2012] [2011] [2010] [2009] [2008] [2007] [2006] [2005] [2004] [2003] [2002] [2001] [2000] [by title] | [Search] Total : 5043 Visitors : 6547 2018 2018 KAIST Math. Colloquium - Conformal field theory in mathematics http://mathnet.or.kr/new_sub04/sub04_01_01.php?no=4563&ko_name=%EA%B0%95%EB%82%A8%EA%B7%9C&paper_id=&key_name=%EA%B0%95%EB%82%A8%EA%B7%9C&key_locale=in( ) 2018-04-12 2018 Discrete Math - Two conjectures in Ramsey-Turán theory (Hong Liu) 2018-04-10 2018 KAIST Math. Colloquium - The geometry and topology of 3-manifolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8181&ko_name=%EC%A0%84%EB%B3%B4%EA%B4%91&paper_id=&key_name=%EC%A0%84%EB%B3%B4%EA%B4%91&key_locale=in( ) 2018-04-05 2018 Discrete Math - The reconfiguration problem for graph homomorpisms (Mark Siggers) 2018-04-03 2018 KAIST Math. Colloquium - Mordell-Weil groups over moderately large number fields http://mathnet.or.kr/new_sub04/sub04_01_01.php?no=4562&ko_name=Yuichiro+Taguchi&paper_id=(Yuichiro Taguchi ) 2018-03-29 2018 Discrete Math - Reachability in a Planar Subdivision with Direction Constraints http://mathnet.or.kr/new_sub04/sub04_01_01.php?no=5167&ko_name=Vigneron%2C+Antoine&paper_id=(Antoine Vigneron) 2018-03-27 - Geometrization and curvature flows I http://mathnet.or.kr/new_sub04/sub04_01_01.php?no=8269&ko_name=Tian%2C+Gang&paper_id=(Gang Tian) 2018-03-22 - Geometrization and curvature flows II http://mathnet.or.kr/new_sub04/sub04_01_01.php?no=8269&ko_name=Tian%2C+Gang&paper_id=(Gang Tian) 2018-03-22 - Asymptotic Group Theory http://mathnet.or.kr/new_sub04/sub04_01_01.php?no=4584&ko_name=Efim+Zelmanov&paper_id=(Efim Zelmanov) 2018-03-21 - Poincare Conjecture and Geometrization http://mathnet.or.kr/new_sub04/sub04_01_01.php?no=8269&ko_name=Tian%2C+Gang&paper_id=(Gang Tian) 2018-03-21 2018 Discrete Math - The reverse Kakeya problem (Otfried Cheong) 2018-03-20 2018 Discrete Math - Characterization of forbidden subgraphs for bounded star-chromatic number ( ) 2018-03-06 2018 Discrete Math - Erdős-Pósa property of chordless cycles and its applications (O-joung Kwon) 2018-01-12 2018 Discrete Math - Counting tree-like graphs in locally dense graphs (Joonkyung Lee) 2018-01-08 Back to top of page 2017 2017 Discrete Math - Spanning trees in a randomly perturbed graphs (Jaehoon Kim) 2017-12-28 2017 Discrete Math - On the maximum number of integer colourings with forbidden monochromatic sums (Hong Liu) 2017-12-27 2017 KAIST - http://mathnet.or.kr/new_sub04/sub04_01_01.php?no=1326&ko_name=%EC%9D%B4%EC%9A%A9%ED%9B%88&paper_id=&key_name=%EC%9D%B4%EC%9A%A9%ED%9B%88&key_locale=in( ) 2017-11-23 - AI ( ) 2017-11-21 - Algebraic construction of equivariant oriented cohomology of flag varieties II-I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8266&ko_name=Zhong%2C+Changlong&paper_id=(Changlong Zhong) 2017-11-14 - Algebraic construction of equivariant oriented cohomology of flag varieties II-II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8266&ko_name=Zhong%2C+Changlong&paper_id=(Changlong Zhong) 2017-11-14 2017 Discrete Math - The Best Way to Spread a Rumour in a High-Dimensional Grid http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8267&ko_name=Noel%2C+Jonathan+A.+&paper_id=(Noel Jonathan) 2017-11-14 - Algebraic construction of equivariant oriented cohomology of flag varieties I-I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8266&ko_name=Zhong%2C+Changlong&paper_id=(Changlong Zhong) 2017-11-13 - Algebraic construction of equivariant oriented cohomology of flag varieties I-II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8266&ko_name=Zhong%2C+Changlong&paper_id=(Changlong Zhong) 2017-11-13 2017 KAIST Math. Colloquium - Global Dynamics Beyond Hyperbolicity http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1149&ko_name=%EC%9D%B4%EA%B1%B4%ED%9D%AC&paper_id=&key_name=%EC%9D%B4%EA%B1%B4%ED%9D%AC&key_locale=in( ) 2017-11-09 OPEN KAIST - : http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8020&ko_name=%EA%B9%80%EC%9E%AC%EA%B2%BD&paper_id=&key_name=%EA%B9%80%EC%9E%AC%EA%B2%BD&key_locale=in( ) 2017-11-03 OPEN KAIST - : http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4229&ko_name=%EC%97%84%EC%83%81%EC%9D%BC&paper_id=&key_name=%EC%97%84%EC%83%81%EC%9D%BC&key_locale=in( ) 2017-11-03 2017 KAIST Math. Colloquium - How to decide when the world is changing? (Krešimir Josic) 2017-11-02 2017 KAIST Math. Colloquium - Embeddability problem in right-angled Artin groups http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3767&ko_name=%EC%9D%B4%EC%96%B8%EA%B2%BD&paper_id=&key_name=%EC%9D%B4%EC%96%B8%EA%B2%BD&key_locale=in( ) 2017-10-26 2017 Discrete Math - Limits of order types http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4661&ko_name=Xavier+Goaoc&paper_id=(Xavier Goaoc) 2017-09-29 2017 Discrete Math - Subquadratic algorithms for the diameter and the sum of pairwise distances in planar graphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4426&ko_name=Sergio+Cabello&paper_id=(Sergio Cabello) 2017-09-26 2017 Discrete Math - Shatter functions of (geometric) hypergraphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4661&ko_name=Xavier+Goaoc&paper_id=(Xavier Goaoc) 2017-09-25 2017 KAIST Math. Colloquium - Functional Approach to Stochastic Integrals http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1813&ko_name=%EC%A7%80%EC%9A%B4%EC%8B%9D&paper_id=&key_name=%EC%A7%80%EC%9A%B4%EC%8B%9D&key_locale=in( ) 2017-09-07 2017 Discrete Math - Property testing for hypergraphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8158&ko_name=%EA%B9%80%EC%9E%AC%ED%9B%88&paper_id=( ) 2017-07-27 2017 Discrete Math - The Complexity of Counting Generalized Colorings: New Results and Challenges http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8013&ko_name=Makowsky%2C+Johann+Andreas+&paper_id=(Johann A. Makowsky) 2017-07-14 2017 Discrete Math - Negative correlation and Hodge-Riemann relations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8177&ko_name=%ED%97%88%EC%A4%80%EC%9D%B4&paper_id=( ) 2017-07-12 2017 Discrete Math - On the Price of Satisficing in Network User Equilibria http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8176&ko_name=%EA%B6%8C%EC%B0%BD%ED%98%84&paper_id=( ) 2017-07-10 2017 Discrete Math - On the colourful Helly theorem http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8175&ko_name=Rold%C3%A1n-Pensado%2C+Edgardo+&paper_id=(Edgardo Roldán-Pensado) 2017-07-07 2017 Discrete Math - FPT Approximation Algorithms for Graph Problems ( ) 2017-07-06 2017 Discrete Math - On Entropy Inequalities of Sums in Prime Cyclic Groups ( ) 2017-06-19 2017 CMC Distinguished Lecture Series by Terence Tao - Finite time blowup constructions for supercritical equations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4435&ko_name=Terence+Chi-Shen+Tao&paper_id=(Terence Tao) 2017-06-16 2017 Discrete Math - Highly connected subgraphs in sparse graphs (Henry Liu) 2017-06-15 2017 CMC Distinguished Lecture Series by Terence Tao - The Erdős discrepancy problem http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4435&ko_name=Terence+Chi-Shen+Tao&paper_id=(Terence Tao) 2017-06-15 2017 Discrete Math - On low rank-width colorings ( ) 2017-06-09 2017 KAIST Math. Colloquium - The beauty and Usefulness of the Circle http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8171&ko_name=%EB%B0%B1%ED%98%95%EB%A0%AC&paper_id=&key_name=%EB%B0%B1%ED%98%95%EB%A0%AC&key_locale=in( ) 2017-06-01 2017 KAIST Math. Colloquium - Dynamics and Arithmetic of L-values http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5070&ko_name=%EC%84%A0%ED%95%B4%EC%83%81&paper_id=&key_name=%EC%84%A0%ED%95%B4%EC%83%81&key_locale=in( ) 2017-0525 Geometric Topology Fair 2017 - Diophantine approximation and homogeneous dynamics http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4582&ko_name=%EC%9E%84%EC%84%A0%ED%9D%AC&paper_id=&key_name=%EC%9E%84%EC%84%A0%ED%9D%AC&key_locale=in(Seonhee Lim) 2017-05-12 Geometric Topology Fair 2017 - Fast computation in mapping class groups http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8174&ko_name=Balazs%2C+Strenner+&paper_id=(Balazs Strenner) 2017-05-12 Geometric Topology Fair 2017 - Discontinuous motions of Cannon-Thurston maps http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4409&ko_name=kenichi+Ohshika&paper_id=(Kenichi Ohshika) 2017-05-12 Geometric Topology Fair 2017 - Embeddability between RAAGs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4330&ko_name=%EC%9D%B4%EC%83%81%EC%A7%84&paper_id=&key_name=%EC%9D%B4%EC%83%81%EC%A7%84&key_locale=in(Sang Jin Lee) 2017-05-12 Geometric Topology Fair 2017 - Boundary amenability for Out(F_n) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2603&ko_name=Mladen+Bestvina&paper_id=Bestvina(Mladen Bestvina) 2017-05-11 Geometric Topology Fair 2017 - Fibered commensurability on Out(F_n) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8172&ko_name=Hidetoshi%2C+Masai+&paper_id=(Hidetoshi Masai) 2017-05-11 Geometric Topology Fair 2017 - Cohomology of the moduli space of graphs and groups of homology cobordisms of surfaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8173&ko_name=Takuya%2C+Sakasai+&paper_id=(Takuya Sakasai) 2017-05-11 Geometric Topology Fair 2017 - Constructions of hyperbolic surfaces with long systoles. (Bram Petri) 2017-05-11 2017 KAIST Math. Colloquium - Patterns of Synchrony: From Animal Gaits to Binocular Rivalry (Marty Golubitsky) 2017-05-11 - Random walks in hyperbolic spaces III-I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2603&ko_name=Mladen+Bestvina&paper_id=Bestvina(Mladen Bestvina) 2017-05-09 - Random walks in hyperbolic spaces III-II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2603&ko_name=Mladen+Bestvina&paper_id=Bestvina(Mladen Bestvina) 2017-05-09 2017 Discrete Math - Nerves, minors, and piercing numbers http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4281&ko_name=Andreas+Holmsen&paper_id=&key_name=holmsen&key_locale=in(Andreas Holmsen) 2017-05-08 - Random walks in hyperbolic spaces II-I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2603&ko_name=Mladen+Bestvina&paper_id=Bestvina(Mladen Bestvina) 2017-05-04 - Random walks in hyperbolic spaces II-II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2603&ko_name=Mladen+Bestvina&paper_id=Bestvina(Mladen Bestvina) 2017-05-04 - Random walks in hyperbolic spaces I-I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2603&ko_name=Mladen+Bestvina&paper_id=Bestvina(Mladen Bestvina) 2017-05-02 - Random walks in hyperbolic spaces I-II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2603&ko_name=Mladen+Bestvina&paper_id=Bestvina(Mladen Bestvina) 2017-05-02 2017 BK21 - Containment Problems and Chudnovsky|'s conjecture http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4382&ko_name=Brian+Harbourne&paper_id=(Brian Harbourne) 2017-04-26 2017 BK21 - The Bounded Negativity Conjecture and H-constants http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4382&ko_name=Brian+Harbourne&paper_id=(Brian Harbourne) 2017-04-25 2017 BK21 - Negative curves and related asymptotic quantities http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4382&ko_name=Brian+Harbourne&paper_id=(Brian Harbourne) 2017-04-25 2017 Discrete Math - Eigenpolytopes, Equitable Partitions, and EKR-type Theorems http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8024&ko_name=Rooney%2C+Brendan&paper_id=(Brendan Rooney ) 2017-04-24 2017 Discrete Math - Bi-Topological Spaces and the Continuity Problem http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8169&ko_name=Dieter%2C+Spreen&paper_id=(Dieter Spreen) 2017-04-17 2017 KAIST Math. Colloquium - Intraspecific Competitions in Cyclic Game Systems http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4244&ko_name=%EB%8F%84%EC%98%81%ED%95%B4&paper_id=&key_locale=in( ) 2017-04-13 2017 Discrete Math - Putting your coin collection on a shelf (Otfried Cheong) 2017-04-03 2017 KAIST Math. Colloquium - ( ) 2017-03-30 2017 KAIST Math. Colloquium - Switching Diffusions and Applications http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8166&ko_name=George%2C+Yin&paper_id=(George Yin) 2017-03-16 2017 KAIST Math. Colloquium - http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4896&ko_name=%EB%B0%95%EC%A7%84%ED%95%B4&paper_id=&key_name=%EB%B0%95%EC%A7%84%ED%95%B4&key_locale=in( ) 2017-03-09 2017 Discrete Math - 3-coloring triangle-free planar graphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8165&ko_name=Bernard%2C+Lidick%C3%BD+&paper_id=(Bernard Lidicky) 2017-03-07 2017 Discrete Math - The second largest eigenvalue and vertex-connectivity in regular graphs (Suil O) 2017-02-03 Back to top of page 2016 The 4th Korea Toric Topology Winter Workshop - Algebras from oriented triangulated manifolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4691&ko_name=Zhi+Lu&paper_id=(Zhi Lu ) 2016-12-29 The 4th Korea Toric Topology Winter Workshop - On descriptions of products of simplices (Li Yu ) 2016-12-29 The 4th Korea Toric Topology Winter Workshop - The formula for the real Buchstaber invariants of skeleta of a simplex (Hyun Woong Cho) 2016-12-29 The 4th Korea Toric Topology Winter Workshop - Lagrangian fibers on Gelfand-Cetlin systems (Yoosik Kim) 2016-12-28 The 4th Korea Toric Topology Winter Workshop - (Toric) Residue Mirror Symmetry (Jeongseok Oh) 2016-12-28 The 4th Korea Toric Topology Winter Workshop - Volume growth in the component of the fibered Dehn twist (Joontae Kim) 2016-12-28 The 4th Korea Toric Topology Winter Workshop - Algebra Topology of Configuration space (Hao Li) 2016-12-28 2016 Discrete Math - Tree packing conjecture for bounded degree trees http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8158&ko_name=%EA%B9%80%EC%9E%AC%ED%9B%88&paper_id=( ) 2016-12-28 The 4th Korea Toric Topology Winter Workshop - Wedge operation and classification of toric spaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5095&ko_name=%EB%B0%95%ED%95%9C%EC%B2%A0&paper_id=&key_name=%EB%B0%95%ED%95%9C%EC%B2%A0&key_locale=in(Hanchul Park ) 2016-12-27 The 4th Korea Toric Topology Winter Workshop - Classification of toric manifolds over the vertex cut of a cube (Hideya Kuwata) 2016-12-27 The 4th Korea Toric Topology Winter Workshop - Wedge operation on toric orbifolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5091&ko_name=%EC%86%A1%EC%A2%85%EB%B0%B1&paper_id=&key_name=%EC%86%A1%EC%A2%85%EB%B0%B1&key_locale=in(Jongbaek Song) 2016-12-27 The 4th Korea Toric Topology Winter Workshop - A type-A Weyl group action on the associated real toric manifold http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4415&ko_name=Shizuo+Kaji&paper_id=(Shizuo Kaji) 2016-12-27 The 4th Korea Toric Topology Winter Workshop - Hessenberg varieties and hyperplane arrangements (Tatsuya Horiguchi) 2016-12-27 The 4th Korea Toric Topology Winter Workshop - Newton-Okounkov polytopes of flag varieties of classical types (Naoki Fujita) 2016-12-27 The 4th Korea Toric Topology Winter Workshop - Towers in Toric Topology (Eunjeong Lee) 2016-12-27 The 4th Korea Toric Topology Winter Workshop - Geometrically bounding 3-Manifolds (Fangting Zheng) 2016-12-27 The 4th Korea Toric Topology Winter Workshop - Cohomological rigidity of manifolds arisen from Pogorelov class http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5092&ko_name=%EB%B0%95%EC%84%A0%EC%A0%95&paper_id=&key_name=%EB%B0%95%EC%84%A0%EC%A0%95&key_locale=in(Seonjeong Park) 2016-12-26 The 4th Korea Toric Topology Winter Workshop - Cohomology of non-orientable toric origami manifolds (Haozhi Zeng) 2016-12-26 Harmony of Real and Complex Algebraic Geometry - Matrix Completion and Free Resolutions II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8156&ko_name=Sinn%2C+Rainer+&paper_id=(Rainer Sinn) 2016-12-09 Harmony of Real and Complex Algebraic Geometry - Toric geometry applied to secant and tangential varieties II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8050&ko_name=Micha%C5%82ek%2C+Mateusz+&paper_id=(Mateusz Michalek) 2016-12-08 Harmony of Real and Complex Algebraic Geometry - Nonnegative Polynomials and Sums of Squares II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8157&ko_name=Greg%2C+Blekherman&paper_id=(Greg Blekherman) 2016-12-07 Harmony of Real and Complex Algebraic Geometry - Toric geometry applied to secant and tangential varieties I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8050&ko_name=Micha%C5%82ek%2C+Mateusz+&paper_id=(Mateusz Michalek) 2016-12-07 Harmony of Real and Complex Algebraic Geometry - Nonnegative Polynomials and Sums of Squares I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8157&ko_name=Greg%2C+Blekherman&paper_id=(Greg Blekherman) 2016-12-06 Harmony of Real and Complex Algebraic Geometry - Matrix Completion and Free Resolutions I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8156&ko_name=Sinn%2C+Rainer+&paper_id=(Rainer Sinn) 2016-12-06 2016 KAIST Math. Colloquium - Stable laws for Sinai billiards with cusps at fl at points http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=8145&ko_name=%EC%A0%95%ED%95%B4%EC%A4%80&paper_id=&key_name=%EC%A0%95%ED%95%B4%EC%A4%80&key_locale=in(Paul Jung) 2016-12-01 2016 Discrete Math - Solving the half-integral disjoint paths problem in highly connected digraphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8155&ko_name=Wollan%2C+Paul&paper_id=(Paul Wollan) 2016-11-30 2016 Discrete Math - Generalized feedback vertex set problems on bounded-treewidth graphs (O-joung Kwon) 2016-11-25 2016 KAIST Math. Colloquium - Quantum walks on graphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8153&ko_name=Godsil%2C+Christopher+D.&paper_id=(Chris Godsil ) 2016-11-17 2016 Discrete Math - Homomorphisms of Strongly Regular Graphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8152&ko_name=Roberson%2C+David+E&paper_id=(David Roberson) 2016-11-16 2016 KAIST Math. Colloquium - p-adic multi-zeta values http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8151&ko_name=%C3%9Cnver%2C+Sinan&paper_id=(Sinan Ünver) 2016-11-10 2016 KAIST MFRS Seminar - Topological methods for discrete geometry http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4661&ko_name=Xavier+Goaoc&paper_id=(Xavier Goaoc ) 2016-11-07 2016 KAIST Math. Colloquium - Mathematical Challenges for classical and quantum synchronization http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3955&ko_name=%ED%95%98%EC%8A%B9%EC%97%B4&paper_id=&key_name=%ED%95%98%EC%8A%B9%EC%97%B4&key_locale=in( ) 2016-11-03 2016 KAIST MFRS Seminar - Embedding complete graphs in surfaces: what about higher dimensions? http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4661&ko_name=Xavier+Goaoc&paper_id=(Xavier Goaoc ) 2016-11-02 2016 KAIST Math. Colloquium - Dual Representation Topic Model ( ) 2016-10-27 2016 KAIST CMC Seminar - Secant varieties and asymptotic syzygies http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8150&ko_name=Ein%2C+Lawrence&paper_id=(Lawrence Ein) 2016-10-26 2016 Discrete Math - Introduction to analytic combinatorics http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8149&ko_name=Nicaud%2C+Cyril+&paper_id=(Cyril Nicaud) 2016-10-19 2016 Discrete Math - Introduction of the finite field Erdős distance problem http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5071&ko_name=%EA%B3%A0%EB%91%90%EC%9B%90&paper_id=&key_name=%EA%B3%A0%EB%91%90%EC%9B%90&key_locale=in( ) 2016-10-14 2016 KAIST Math. Colloquium - What happens insides a black hole? http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8148&ko_name=%EC%98%A4%EC%84%B1%EC%A7%84&paper_id=&key_name=%EC%98%A4%EC%84%B1%EC%A7%84&key_locale=in( ) 2016-1006 2016 KAIST Math. Colloquium - ( ) 2016-09-29 KAIST Intensive Lecture Series by Frank-Olaf Schreyer - Lecture VIII: Explicit construcions of Curves II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4480&ko_name=Frank-Olaf+Schreyer&paper_id=(Frank-Olaf Schreyer) 2016-09-29 2016 KAIST CMC Seminar - How to make homogeneous prime ideals of high regularity http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4474&ko_name=David+Eisenbud&paper_id=(David Eisenbud) 2016-09-23 2016 KAIST Math. Colloquium - What graded Betti numbers can tell us? http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4480&ko_name=Frank-Olaf+Schreyer&paper_id=(Frank-Olaf Schreyer) 2016-09-22 KAIST Intensive Lecture Series by Frank-Olaf Schreyer - Lecture VII: Explicit construcions of Curves I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4480&ko_name=Frank-Olaf+Schreyer&paper_id=(Frank-Olaf Schreyer) 2016-09-20 KAIST Intensive Lecture Series by Frank-Olaf Schreyer - Lecture VI: Chow forms and Resultants http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4480&ko_name=Frank-Olaf+Schreyer&paper_id=(Frank-Olaf Schreyer) 2016-09-12 2016 Discrete Math - Unavoidable subtournaments in tournaments with large chromatic number (Ringi Kim ) 2016-09-09 2016 KAIST Math. Colloquium - Theoretical Computer Science for Numerics http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8147&ko_name=Martin+Ziegler&paper_id=(Martin Ziegler ) 2016-09-08 Vertex Algebra - Introduction to vertex algebras V ( ) 2016-09-03 KAIST Intensive Lecture Series by Frank-Olaf Schreyer - Lecture IV: Beilinson Monads and Cohomology of Coherent Sheaves http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4480&ko_name=Frank-Olaf+Schreyer&paper_id=(Frank-Olaf Schreyer) 2016-08-30 KAIST Intensive Lecture Series by Frank-Olaf Schreyer - Lecture V: Chow forms and Resultants http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4480&ko_name=Frank-Olaf+Schreyer&paper_id=(Frank-Olaf Schreyer) 2016-08-30 2016 Syzygies, exterior algebras, coherent sheaf cohomology and applications workshop - The discriminant of a global section of a vector bundle. II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3391&ko_name=Hirotachi+Abo&paper_id=Hirotachi(Hirotachi Abo) 2016-08-27 2016 Syzygies, exterior algebras, coherent sheaf cohomology and applications workshop - Syzygies, Exterior Algebra, and Hyperplane Arrangements. II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8143&ko_name=Schenck+Hal+&paper_id=(Hal Schenck ) 2016-08-27 2016 Syzygies, exterior algebras, coherent sheaf cohomology and applications workshop - Special Ulrich bundles on surfaces http://mathnet.or.kr/new_sub04/sub04_01_01.php? no=8141&ko_name=%EA%B9%80%EC%98%81%EB%9D%BD&paper_id=&key_name=%EA%B9%80%EC%98%81%EB%9D%BD&key_locale=in(Yeongrak Kim) 2016-08-26 2016 Syzygies, exterior algebras, coherent sheaf cohomology and applications workshop - Tate resolutions and direct image complexes. II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4480&ko_name=Frank-Olaf+Schreyer&paper_id=(Frank-Olaf Schreyer) 2016-08-26 2016 Syzygies, exterior algebras, coherent sheaf cohomology and applications workshop - Tate resolutions and direct image complexes. I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4480&ko_name=Frank-Olaf+Schreyer&paper_id=(Frank-Olaf Schreyer) 2016-08-25 2016 Syzygies, exterior algebras, coherent sheaf cohomology and applications workshop - Symbolic powers of sums of ideals. II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8138&ko_name=Trung%2C+Ngo+Viet&paper_id=(Ngo Viet Trung) 2016-08-25 2016 Syzygies, exterior algebras, coherent sheaf cohomology and applications workshop - The discriminant of a global section of a vector bundle. I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3391&ko_name=Hirotachi+Abo&paper_id=Hirotachi(Hirotachi Abo) 2016-08-25 2016 Syzygies, exterior algebras, coherent sheaf cohomology and applications workshop - ACM sheaves on the double plane http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4774&ko_name=%ED%97%88%EC%84%9D%EB%AC%B8&paper_id=&key_locale=in(Suk Moon Huh) 2016-08-25 2016 Syzygies, exterior algebras, coherent sheaf cohomology and applications workshop - Syzygies, Exterior Algebra, and Hyperplane Arrangements. I (Hal Schenck ) 2016-08-24 2016 Syzygies, exterior algebras, coherent sheaf cohomology and applications workshop - Symbolic powers of sums of ideals I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8138&ko_name=Trung%2C+Ngo+Viet&paper_id=(Ngo Viet Trung) 2016-08-24 2016 Syzygies, exterior algebras, coherent sheaf cohomology and applications workshop - Multisecant Line and Regularity http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3952&ko_name=%EB%B0%95%EC%9D%98%EC%84%B1&paper_id=&key_name=%EB%B0%95%EC%9D%98%EC%84%B1&key_locale=in(Eui-Sung Park) 2016-08-24 2016 Syzygies, exterior algebras, coherent sheaf cohomology and applications workshop - Classification and syzygies of algebraic varieties with 2-regular structure sheaves (Jinhyung Park ) 2016-08-24 2016 Syzygies, exterior algebras, coherent sheaf cohomology and applications workshop - K3 surfaces and the Hurwitz space of degree 6 covers of P^1 by genus 9 curves http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8139&ko_name=Christian+Bopp+&paper_id=(Christian Bopp ) 201608-24 KAIST Intensive Lecture Series by Frank-Olaf Schreyer - Lecture III: BGG-correspondence and reciprocity http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4480&ko_name=Frank-Olaf+Schreyer&paper_id=(Frank-Olaf Schreyer) 2016-08-18 KAIST Intensive Lecture Series by Frank-Olaf Schreyer - Lecture I : An overview on Tate resolution on projective space http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4480&ko_name=Frank-Olaf+Schreyer&paper_id=(Frank-Olaf Schreyer) 2016-08-17 KAIST Intensive Lecture Series by Frank-Olaf Schreyer - Lecture II : An overview on Tate resolution on projective space http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4480&ko_name=Frank-Olaf+Schreyer&paper_id=(Frank-Olaf Schreyer) 2016-08-17 Vertex Algebra - Introduction to vertex algebras IV ( ) 2016-08-09 Vertex Algebra - Introduction to vertex algebras III ( ) 2016-07-27 2016 Combinatorics Workshop (2016 ) - Homological connectivity of random hypergraphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4571&ko_name=%EA%B0%95%EB%AF%B8%ED%98%84&paper_id=(Mihyun Kang) 2016-07-23 2016 Combinatorics Workshop (2016 ) - Maximal green sequences for quivers of finite mutation type http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8135&ko_name=%EC%9D%B4%EA%B2%BD%EC%9A%A9&paper_id=&key_locale=in(Kyungyong Lee) 2016-07-22 2016 Combinatorics Workshop (2016 ) - Introduction to the affine Schubert polynomials. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8136&ko_name=%EC%9D%B4%EC%8A%B9%EC%A7%84&paper_id=&key_locale=in(Seungjin Lee) 2016-07-22 2016 Combinatorics Workshop (2016 ) - Homogeneous selections and regularity in oriented matroids http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4281&ko_name=Andreas+Holmsen&paper_id=&key_name=holmsen&key_locale=in(Andreas Holmsen ) 2016-07-21 Vertex Algebra - Introduction to vertex algebras II ( ) 2016-07-12 2016 KAIST - (lattice based cryptography) I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8133&ko_name=%EC%9C%A4%EC%95%84%EB%9E%8C&paper_id=&key_locale=in( ) 2016-07-07 2016 KAIST - (lattice based cryptography) II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8133&ko_name=%EC%9C%A4%EC%95%84%EB%9E%8C&paper_id=&key_locale=in( ) 2016-07-07 2016 KAIST - (lattice based cryptography) I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1842&ko_name=%EC%B2%9C%EC%A0%95%ED%9D%AC&paper_id=&key_locale=in( ) 2016-07-06 2016 KAIST - (lattice based cryptography) II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1842&ko_name=%EC%B2%9C%EC%A0%95%ED%9D%AC&paper_id=&key_locale=in( ) 2016-07-06 2016 CMC Distinguished Lecture by Mladen Bestvina - On the large-scale geometry of mapping class groups http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2603&ko_name=Mladen+Bestvina&paper_id=Bestvina(Mladen Bestvina ) 2016-07-04 2016 Discrete Math - Packing and covering topological minors and immersions http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8124&ko_name=Liu%2C+Chun-Hung&paper_id=(Chun-Hung Liu) 2016-06-29 Vertex Algebra - Introduction to vertex algebras I ( ) 2016-06-28 2016 KAIST - http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3745&ko_name=%EB%B0%95%ED%98%95%EC%A3%BC&paper_id=&key_locale=in( ) 2016-06-07 2016 Discrete Math - Interlacing families and the Hermitian spectral norm of digraphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5123&ko_name=O%2C+Suil&paper_id=( ) 2016-06-01 2016 Discrete Math - On the Erdős-Szekeres convex polygon problem http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4281&ko_name=Andreas+Holmsen&paper_id=&key_name=holmsen&key_locale=in(Andreas Holmsen ) 2016-05-27 2016 KAIST Math. Colloquium - Simplifying polynomials by Tschirnhaus transformations: old and new http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2783&ko_name=Zinovy+Reichstein&paper_id=Reichstein(Zinovy Reichstein ) 2016-05-26 2016 KAIST Math. Colloquium - Frontier of the New Biology: Interplay between Mathematical Models and Complex Data http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8051&ko_name=Nie%2C+Qing&paper_id=(Qing Nie) 2016-05-19 2016 KAIST CMC Seminar - Introduction to secant varieties http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8050&ko_name=Micha%C5%82ek%2C+Mateusz+&paper_id=(Mateusz Michalek) 2016-05-18 2016 KAIST CMC Seminar - Scant varieties and representation theory http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8050&ko_name=Micha%C5%82ek%2C+Mateusz+&paper_id=(Mateusz Michalek) 2016-05-18 2016 Topology Seminar - Lagrangian fibers of Gelfand-Cetlin systems I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8049&ko_name=%EC%A1%B0%EC%9C%A4%ED%98%95&paper_id=&key_name=%EC%A1%B0%EC%9C%A4%ED%98%95&key_locale=in(Yunhyung Cho) 2016-05-12 2016 Topology Seminar - Lagrangian fibers of Gelfand-Cetlin systems II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8049&ko_name=%EC%A1%B0%EC%9C%A4%ED%98%95&paper_id=&key_name=%EC%A1%B0%EC%9C%A4%ED%98%95&key_locale=in(Yunhyung Cho) 2016-05-12 2016 Topology Seminar - Lagrangian fibers of Gelfand-Cetlin systems III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=8049&ko_name=%EC%A1%B0%EC%9C%A4%ED%98%95&paper_id=&key_name=%EC%A1%B0%EC%9C%A4%ED%98%95&key_locale=in(Yunhyung Cho) 2016-05-12 2016 Topology Seminar - Lagrangian fibers of Gelfand-Cetlin systems IV http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=8049&ko_name=%EC%A1%B0%EC%9C%A4%ED%98%95&paper_id=&key_name=%EC%A1%B0%EC%9C%A4%ED%98%95&key_locale=in(Yunhyung Cho) 2016-05-12 2016 KAIST Math. Colloquium - Plateau's problem for C^1, tangentially immersed boundaries http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8048&ko_name=Rosales%2C+Leobardo&paper_id=(Leobardo Rosales ) 2016-05-12 2016 Discrete Math - The Salesman’s Improved Paths http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8047&ko_name=Seb%C5%91%2C+Andr%C3%A1s+&paper_id=(András Sebő) 2016-05-04 2016 KAIST Math. Colloquium - Classical tools and recent advances in combinatorial optimization http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8047&ko_name=Seb%C5%91%2C+Andr%C3%A1s+&paper_id=(András Sebő ) 2016-04-28 2016 KAIST CMC Mathematical Biology Conference on Kinetic models and traveling wave phenomenon in mathematical biology - Blowup and global solutions in a chemotaxis-growth system http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4178&ko_name=%EA%B0%95%EA%B2%BD%EA%B7%BC&paper_id=&key_locale=in(Kyungkeun Kang ) 2016-04-22 2016 KAIST CMC Mathematical Biology Conference on Kinetic models and traveling wave phenomenon in mathematical biology - Kinetic equations, scaling limits and applications in biology VIII http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=8041&ko_name=Hillen%2C+Thomas&paper_id=(Thomas Hillen ) 2016-04-22 2016 KAIST CMC Mathematical Biology Conference on Kinetic models and traveling wave phenomenon in mathematical biology - A KINETIC CHEMOTAXIS MODEL FROM FOOD METRIC http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=8046&ko_name=%EC%B5%9C%EC%84%A0%ED%98%B8&paper_id=&key_name=%EC%B5%9C%EC%84%A0%ED%98%B8&key_locale=in(Sun-Ho Choi) 2016-04-21 2016 KAIST CMC Mathematical Biology Conference on Kinetic models and traveling wave phenomenon in mathematical biology - Kinetic equations, scaling limits and applications in biology VI http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8041&ko_name=Hillen%2C+Thomas&paper_id= (Thomas Hillen ) 2016-04-21 2016 KAIST CMC Mathematical Biology Conference on Kinetic models and traveling wave phenomenon in mathematical biology - Interacting population models with nonlinear diffusion in ecology http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=939&ko_name=%EC%95%88%EC%9D%B8%EA%B2%BD&paper_id=&key_name=%EC%95%88%EC%9D%B8%EA%B2%BD&key_locale=in(Inkyung Ahn ) 2016-04-21 2016 KAIST CMC Mathematical Biology Conference on Kinetic models and traveling wave phenomenon in mathematical biology - Kinetic equations, scaling limits and applications in biology VII http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=8041&ko_name=Hillen%2C+Thomas&paper_id=(Thomas Hillen ) 2016-04-21 2016 KAIST CMC Mathematical Biology Conference on Kinetic models and traveling wave phenomenon in mathematical biology - Evolution of dispersal with starvation measure and coexistence http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2242&ko_name=%EA%B6%8C%EC%98%A4%EC%83%81&paper_id=&key_name=%EA%B6%8C%EC%98%A4%EC%83%81&key_locale=in(Ohsang Kwon) 2016-04-21 2016 KAIST CMC Mathematical Biology Conference on Kinetic models and traveling wave phenomenon in mathematical biology - Front propagation in reaction-diffusion systems V http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4878&ko_name=Hiroshi+Matano&paper_id=(Hiroshi Matano ) 2016-04-20 2016 KAIST CMC Mathematical Biology Conference on Kinetic models and traveling wave phenomenon in mathematical biology - Kinetic equations, scaling limits and applications in biology IV http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8041&ko_name=Hillen%2C+Thomas&paper_id= (Thomas Hillen ) 2016-04-20 2016 KAIST CMC Mathematical Biology Conference on Kinetic models and traveling wave phenomenon in mathematical biology - Classical and quantum synchoronization Mathematics driven by biology http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3955&ko_name=%ED%95%98%EC%8A%B9%EC%97%B4&paper_id=&key_name=%ED%95%98%EC%8A%B9&key_locale=in(Seung-Yeal Ha) 2016-04-20 2016 KAIST CMC Mathematical Biology Conference on Kinetic models and traveling wave phenomenon in mathematical biology - Kinetic equations, scaling limits and applications in biology V http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8041&ko_name=Hillen%2C+Thomas&paper_id= (Thomas Hillen ) 2016-04-20 2016 KAIST CMC Mathematical Biology Conference on Kinetic models and traveling wave phenomenon in mathematical biology - Front propagation in reaction-diffusion systems III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4878&ko_name=Hiroshi+Matano&paper_id=(Hiroshi Matano ) 2016-04-19 2016 KAIST CMC Mathematical Biology Conference on Kinetic models and traveling wave phenomenon in mathematical biology - Kinetic equations, scaling limits and applications in biology II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8041&ko_name=Hillen%2C+Thomas&paper_id= (Thomas Hillen ) 2016-04-19 2016 KAIST CMC Mathematical Biology Conference on Kinetic models and traveling wave phenomenon in mathematical biology - Front propagation in reaction-diffusion systems IV http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4878&ko_name=Hiroshi+Matano&paper_id=(Hiroshi Matano ) 2016-04-19 2016 KAIST CMC Mathematical Biology Conference on Kinetic models and traveling wave phenomenon in mathematical biology - Kinetic equations, scaling limits and applications in biology III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8041&ko_name=Hillen%2C+Thomas&paper_id= (Thomas Hillen ) 2016-04-19 2016 KAIST CMC Mathematical Biology Conference on Kinetic models and traveling wave phenomenon in mathematical biology - Front propagation in reaction-diffusion systems I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4878&ko_name=Hiroshi+Matano&paper_id=(Hiroshi Matano ) 2016-04-18 2016 KAIST CMC Mathematical Biology Conference on Kinetic models and traveling wave phenomenon in mathematical biology - Kinetic equations, scaling limits and applications in biology I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8041&ko_name=Hillen%2C+Thomas&paper_id= (Thomas Hillen ) 2016-04-18 2016 KAIST CMC Mathematical Biology Conference on Kinetic models and traveling wave phenomenon in mathematical biology - Front propagation in reaction-diffusion systems II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4878&ko_name=Hiroshi+Matano&paper_id=(Hiroshi Matano ) 2016-04-18 Workshop on algebraic surfaces and moduli - Line configurations and new rigid surfaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4765&ko_name=Ingrid+Bauer&paper_id=(Ingrid Bauer ) 2016-04-15 Workshop on algebraic surfaces and moduli - Geometric compactifications of moduli of K3 surfaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4288&ko_name=Valery+Alexeev&paper_id=(Valery Alexeev) 2016-04-15 Workshop on algebraic surfaces and moduli - Cylinders in rational surfaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7992&ko_name=%EC%9B%90%EC%A4%80%ED%98%95&paper_id=&key_name=%EC%9B%90%EC%A4%80&key_locale=in(Joonyeong Won ) 201604-14 2016 KAIST Math. Colloquium - Configurations of lines and interesting algebraic surfaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4537&ko_name=Fabrizio+Catanese&paper_id=(Fabrizio Catanese) 2016-04-14 Workshop on algebraic surfaces and moduli - Effective behavior of the pluricanonical systems of an ODE on an algebraic surface http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4764&ko_name=Sheng-Li+Tan&paper_id=(Sheng-Li Tan ) 2016-04-14 Workshop on algebraic surfaces and moduli - An explicit construction of Schoen surfaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8043&ko_name=Xavier%2C+Roulleau&paper_id=(Xavier Roulleau ) 2016-04-14 Workshop on algebraic surfaces and moduli - On triple planes with p_g=q=0 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4430&ko_name=Francesco+Polizzi&paper_id=(Francesco Polizzi ) 2016-04-13 Workshop on algebraic surfaces and moduli - The Craighero-Gattazzo surface is simply-connected http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8045&ko_name=Giancarlo%2C+Urzua&paper_id=(Giancarlo Urzua ) 2016-04-13 Workshop on algebraic surfaces and moduli - On rational dominant maps from surfaces of general type http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4768&ko_name=Gian+Pietro+Pirola&paper_id=(Gian Pietro Pirola) 2016-04-12 Workshop on algebraic surfaces and moduli - Continuous rank and higher dimensional Castelnuovo and Clifford-Severi inequalities on varieties of maximal Albanese dimension. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4771&ko_name=Miguel+Barja&paper_id=(Miguel Angel Barja ) 2016-04-12 Workshop on algebraic surfaces and moduli - Deformations of weighted homogeneous surface singularities admitting rational homology disk smoothings http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=850&ko_name=%EC%8B%A0%EB%8F%99%EC%88%98&paper_id=&key_name=%EC%8B%A0%EB%8F%99%EC%88%98&key_locale=in(Dongsoo Shin) 2016-04-12 Workshop on algebraic surfaces and moduli - Canonical surfaces of high degree for p_g=4, 5, 6. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4537&ko_name=Fabrizio+Catanese&paper_id=(Fabrizio Catanese ) 2016-04-11 Workshop on algebraic surfaces and moduli - Surfaces of general type with q=2 are rigidified http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8042&ko_name=Wenfei%2C+Liu&paper_id=(Wenfei Liu ) 2016-04-11 Workshop on algebraic surfaces and moduli - Eventual properties of continuous linear systems on irregular varieties http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8044&ko_name=Stoppino%2C+Lidia&paper_id=(Lidia Stopino ) 2016-04-11 Workshop on algebraic surfaces and moduli - Cascades of singular del Pezzo surfaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4773&ko_name=%ED%99%A9%EB%8F%99%EC%84%A0&paper_id=&key_pos=%EC%95%84%EC%A3%BC%EB%8C%80%ED%95%99%EA%B5%90&key_locale=in(DongSeon Hwang ) 2016-04-11 2016 KAIST Math. Colloquium - Mathematical modelling with fully anisotropic diffusion http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8041&ko_name=Hillen%2C+Thomas&paper_id=(Thomas Hillen) 2016-04-07 2016 KAIST CMC Annual Lecture Series by John Ball - Interfaces in Solid and Liquid Crystals II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4890&ko_name=John+MacLeod+Ball&paper_id=(John Ball) 2016-04-06 2016 KAIST CMC Annual Lecture Series by John Ball - Interfaces in Solid and Liquid Crystals III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4890&ko_name=John+MacLeod+Ball&paper_id=(John Ball) 2016-04-06 2016 Discrete Math - LP-based Algorithms for Capacitated Facility Location (Hyung-Chan An ) 2016-04-06 2016 KAIST CMC Annual Lecture Series by John Ball - Interfaces in Solid and Liquid Crystals I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4890&ko_name=John+MacLeod+Ball&paper_id=(John Ball) 2016-04-05 2016 Topology Seminar - Schubert calculus and Gelfand-Cetlin polytopes (Part III) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7391&ko_name=Li%2C+Changzheng+&paper_id=(Changzheng Li ) 2016-03-31 2016 Topology Seminar - Schubert calculus and Gelfand-Cetlin polytopes (Part IV) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7391&ko_name=Li%2C+Changzheng+&paper_id=(Changzheng Li ) 2016-03-31 2016 Topology Seminar - Schubert calculus and Gelfand-Cetlin polytopes (Part I) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7391&ko_name=Li%2C+Changzheng+&paper_id=(Changzheng Li ) 2016-03-24 2016 Topology Seminar - Schubert calculus and Gelfand-Cetlin polytopes (Part II) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7391&ko_name=Li%2C+Changzheng+&paper_id=(Changzheng Li ) 2016-03-24 2016 KAIST Math. Colloquium - Disk embedding in dimension 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3904&ko_name=%EC%B0%A8%EC%9E%AC%EC%B6%98&paper_id=&key_name=%EC%B0%A8%EC%9E%AC%EC%B6%98&key_locale=in( ) 2016-0317 2016 KAIST Math. Colloquium - Topology of real toric spaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4471&ko_name=%EC%B5%9C%EC%88%98%EC%98%81&paper_id=&key_name=%EC%B5%9C%EC%88%98%EC%98%81&key_locale=in( ) 2016-03-10 2016 Discrete Math - Improper coloring graphs on surfaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5096&ko_name=%EC%B5%9C%EC%9D%BC%EA%B7%9C&paper_id=&key_name=%EC%B5%9C%EC%9D%BC%EA%B7%9C&key_locale=in(Ilkyoo Choi ) 2016-03-09 2016 Discrete Math - On properties of almost all matroids http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8026&ko_name=%EC%98%A5%EC%84%B1%EB%AF%BC&paper_id=&key_name=%EC%98%A5%EC%84%B1%EB%AF%BC&key_locale=in(Seongmin Ok ) 2016-02-12 Back to top of page 2015 2015 KAIST Math. Colloquium - An Abel-Jacobi invariant in motivic homotopy theory http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8028&ko_name=Quick%2C+Gereon&paper_id=(Gereon Quick) 2015-12-10 2015 KAIST Math. Colloquium - Recent History of Korean Mathematics http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2313&ko_name=%EA%B9%80%EB%8F%84%ED%95%9C&paper_id=&key_name=%EA%B9%80%EB%8F%84%ED%95%9C&key_locale=in( ) 201512-03 2015 Discrete Math - Minimum Weight Perfect Matching via Blossom Belief Propagation ( ) 2015-12-02 2015 KAIST Math. Colloquium - Belief Propagation for Combinatorial Optimization ( ) 2015-11-19 2015 Discrete Math - Characterizing 2-crossing-critical graphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4644&ko_name=Bogdan+Oporowski&paper_id=(Bogdan Oporowski) 2015-11-18 2015 - Topology and Combinatorics of real toric spaces IV- 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4471&ko_name=%EC%B5%9C%EC%88%98%EC%98%81&paper_id=&key_name=%EC%B5%9C%EC%88%98%EC%98%81&key_locale=in( ) 2015-1113 2015 - Topology and Combinatorics of real toric spaces IV- 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4471&ko_name=%EC%B5%9C%EC%88%98%EC%98%81&paper_id=&key_name=%EC%B5%9C%EC%88%98%EC%98%81&key_locale=in( ) 2015-1113 2015 - Topology and Combinatorics of real toric spaces IV- 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4471&ko_name=%EC%B5%9C%EC%88%98%EC%98%81&paper_id=&key_name=%EC%B5%9C%EC%88%98%EC%98%81&key_locale=in( ) 2015-1113 2015 Discrete Math - Characterising structure in classes with unbounded clique-width http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8027&ko_name=Brignall%2C+Robert+&paper_id=(Robert Brignall) 2015-11-11 2015 - Topology and Combinatorics of real toric spaces III- 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4471&ko_name=%EC%B5%9C%EC%88%98%EC%98%81&paper_id=&key_name=%EC%B5%9C%EC%88%98%EC%98%81&key_locale=in( ) 2015-1109 2015 - Topology and Combinatorics of real toric spaces III- 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4471&ko_name=%EC%B5%9C%EC%88%98%EC%98%81&paper_id=&key_name=%EC%B5%9C%EC%88%98%EC%98%81&key_locale=in( ) 2015-1109 2015 - Topology and Combinatorics of real toric spaces III- 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4471&ko_name=%EC%B5%9C%EC%88%98%EC%98%81&paper_id=&key_name=%EC%B5%9C%EC%88%98%EC%98%81&key_locale=in( ) 2015-1109 Knots and Spatial Graphs 2015 - The cable \Gamma-polynomial of a knot (Hideo Takioka) 2015-11-07 Knots and Spatial Graphs 2015 - The ribbonlength of knot diagrams (Elizabeth Denne) 2015-11-06 Knots and Spatial Graphs 2015 - Immersions of graphs and embedding between RAAGs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4330&ko_name=%EC%9D%B4%EC%83%81%EC%A7%84&paper_id=&key_name=%EC%9D%B4%EC%83%81%EC%A7%84&key_locale=in(Sang-Jin Lee) 2015-11-06 Knots and Spatial Graphs 2015 - Composite knots obtained by twisting torus knots http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4270&ko_name=%EC%9D%B4%EC%83%81%EC%97%BD&paper_id=&key_name=%EC%9D%B4%EC%83%81%EC%97%BD&key_locale=in(Sangyop Lee) 2015-11-06 Knots and Spatial Graphs 2015 - Lattice Knot and It's Surfaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4197&ko_name=%EA%B9%80%ED%9B%88&paper_id=&key_name=%EA%B9%80%ED%9B%88&key_locale=in(Hun Kim) 2015-11-06 Knots and Spatial Graphs 2015 - New enumeration algorithm on lattice combinatorics http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3945&ko_name=%EC%98%A4%EC%8A%B9%EC%83%81&paper_id=&key_name=%EC%98%A4%EC%8A%B9%EC%83%81&key_locale=in(Seungsang Oh) 2015-11-06 Knots and Spatial Graphs 2015 - Complexities of 3-manifolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3904&ko_name=%EC%B0%A8%EC%9E%AC%EC%B6%98&paper_id=&key_name=%EC%B0%A8%EC%9E%AC%EC%B6%98&key_locale=in(Jae Choon Cha) 2015-11-06 Knots and Spatial Graphs 2015 - Knot concordance and gropes http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3730&ko_name=%EA%B9%80%ED%83%9C%ED%9D%AC&paper_id=&key_name=%EA%B9%80%ED%83%9C%ED%9D%AC&key_locale=in(Taehee Kim) 2015-11-06 2015 KAIST Math. Colloquium - The Mathematics of Life: Signals, Shapes and Measurements http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8025&ko_name=Keener%2C+James+P.&paper_id=(James Keener) 2015-11-06 Knots and Spatial Graphs 2015 - Roots of the Alexander polynomial and Hoste's conjecture (Alexander Stoimenow) 2015-11-05 Knots and Spatial Graphs 2015 - A class of right-angled Artin groups (HyoWon Park) 2015-11-05 2015 Discrete Math - Tutte’s conjecture on minimum number of spanning trees of 3-connected graphs (Seongmin Ok) 2015-11-04 2015 Discrete Math - Colourings, Vector Colourings and Cores http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8024&ko_name=Rooney%2C+Brendan&paper_id=(Brendan Rooney ) 2015-10-28 2015 - Topology and Combinatorics of real toric spaces II -1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4471&ko_name=%EC%B5%9C%EC%88%98%EC%98%81&paper_id=&key_name=%EC%B5%9C%EC%88%98%EC%98%81&key_locale=in( ) 2015-1014 2015 - Topology and Combinatorics of real toric spaces II -2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4471&ko_name=%EC%B5%9C%EC%88%98%EC%98%81&paper_id=&key_name=%EC%B5%9C%EC%88%98%EC%98%81&key_locale=in( ) 2015-1014 2015 - Topology and Combinatorics of real toric spaces II -3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4471&ko_name=%EC%B5%9C%EC%88%98%EC%98%81&paper_id=&key_name=%EC%B5%9C%EC%88%98%EC%98%81&key_locale=in( ) 2015-1014 2015 - Topology and Combinatorics of real toric spaces I -1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4471&ko_name=%EC%B5%9C%EC%88%98%EC%98%81&paper_id=&key_name=%EC%B5%9C%EC%88%98%EC%98%81&key_locale=in( ) 2015-10-07 2015 - Topology and Combinatorics of real toric spaces I -2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4471&ko_name=%EC%B5%9C%EC%88%98%EC%98%81&paper_id=&key_name=%EC%B5%9C%EC%88%98%EC%98%81&key_locale=in( ) 2015-10-07 2015 KAIST Math. Colloquium - : http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1842&ko_name=%EC%B2%9C%EC%A0%95%ED%9D%AC&paper_id=&key_name=%EC%B2%9C%EC%A0%95%ED%9D%AC&key_locale=in( ) 2015-1001 2015 KAIST Math. Colloquium - The dynamical degrees of birational mappings on $\mathbb{P}^2$. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=8023&ko_name=%EA%B9%80%EA%B2%BD%ED%9D%AC&paper_id=&key_name=%EA%B9%80%EA%B2%BD%ED%9D%AC&key_locale=in( ) 2015-09-24 2015 KAIST Math. Colloquium - Introduction of using mathematics to understand biological systems http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=8020&ko_name=%EA%B9%80%EC%9E%AC%EA%B2%BD&paper_id=&key_name=%EA%B9%80%EC%9E%AC%EA%B2%BD&key_locale=in( ) 2015-09-17 2015 KAIST Math. Colloquium - Ramsey numbers of graphs ( ) 2015-09-10 1st Korean Workshop on Graph Theory - Nine Dragon Tree Conjecture http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3837&ko_name=%EA%B9%80%EC%84%9D%EC%A7%84&paper_id=&key_name=%EA%B9%80%EC%84%9D%EC%A7%84&key_locale=in(Seog-Jin Kim) 2015-08-28 1st Korean Workshop on Graph Theory - On a pursuit-evasion model without instantaneous movement http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=8019&ko_name=%EC%B5%9C%EC%A0%95%EC%98%A5&paper_id=&key_name=%EC%B5%9C%EC%A0%95%EC%98%A5&key_locale=in(Jeong Ok Choi) 2015-08-28 1st Korean Workshop on Graph Theory - Several aspects of a skew-morphism http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3661&ko_name=%EA%B6%8C%EC%98%81%EC%88%98&paper_id=&key_name=%EA%B6%8C%EC%98%81%EC%88%98&key_locale=in(Young Soo Kwon) 2015-08-27 1st Korean Workshop on Graph Theory - On isomorphism classes of generalized Fibonacci cubes http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3938&ko_name=%EB%85%B8%EC%9C%A0%EB%AF%B8&paper_id=&key_name=%EB%85%B8%EC%9C%A0%EB%AF%B8&key_locale=in(Yoomi Rho) 2015-08-27 1st Korean Workshop on Graph Theory - Coloring Squares of Kneser Graphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5149&ko_name=%EB%B0%95%EB%B3%B4%EB%9E%8C&paper_id=&key_name=%EB%B0%95%EB%B3%B4%EB%9E%8C&key_locale=in(Boram Park) 2015-08-27 1st Korean Workshop on Graph Theory - Geometric distance-regular graphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3646&ko_name=%EB%B0%A9%EC%84%B8%EC%A0%95&paper_id=&key_name=%EB%B0%A9%EC%84%B8%EC%A0%95&key_locale=in(Sejeong Bang) 2015-08-27 1st Korean Workshop on Graph Theory - On a phase transition of the random intersection graph: Supercritical region (Sang June Lee) 2015-08-27 1st Korean Workshop on Graph Theory - Maximum Matching Width: new characterizations and a fast algorithm for dominating set (Jisu Jeong) 2015-08-27 1st Korean Workshop on Graph Theory - Number of cliques in graphs with a forbidden subdivision http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4229&ko_name=%EC%97%84%EC%83%81%EC%9D%BC&paper_id=&key_name=%EC%97%84%EC%83%81%EC%9D%BC&key_locale=in(Sang-il Oum) 2015-08-26 1st Korean Workshop on Graph Theory - Typical Structure of graphs with no induced even cycles (Jaehoon Kim) 2015-08-26 1st Korean Workshop on Graph Theory - Some Advances on Sidorenko’s Conjecture (Joonkyung Lee) 2015-08-26 2015 KAIST CMC Lecture Series by Marian Aprodu - Generic syzygy schemes and classification http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4414&ko_name=Marian+Aprodu&paper_id=(Marian Aprodu) 2015-08-14 2015 KAIST CMC Lecture Series by Marian Aprodu - Applications of syzygy schemes http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4414&ko_name=Marian+Aprodu&paper_id=(Marian Aprodu) 2015-08-14 2015 KAIST CMC Lecture Series by Joseph Landsberg - More on the geometry of border rank algorithms http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8018&ko_name=Landsberg%2C+Joseph+M.+&paper_id=(Joseph Landsberg) 2015-08-13 2015 KAIST CMC Lecture Series by Marian Aprodu - Strong Castelnuovo Lemma and syzygy schemes http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4414&ko_name=Marian+Aprodu&paper_id=(Marian Aprodu) 2015-08-13 2015 KAIST CMC Lecture Series by Joseph Landsberg - Geometry of Strassen's algorithm. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8018&ko_name=Landsberg%2C+Joseph+M.+&paper_id=(Joseph Landsberg) 2015-08-12 2015 KAIST CMC Lecture Series by Joseph Landsberg - Geometry of border rank algorithms (special curves in Grassmannians) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8018&ko_name=Landsberg%2C+Joseph+M.+&paper_id=(Joseph Landsberg) 2015-08-12 2015 KAIST CMC Lecture Series by Marian Aprodu - Syzygies and Koszulcohomology http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4414&ko_name=Marian+Aprodu&paper_id=(Marian Aprodu) 2015-08-12 2015 KAIST CMC Lecture Series by Joseph Landsberg - Strassen's equations and a classical problem in linear algebra http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8018&ko_name=Landsberg%2C+Joseph+M.+&paper_id=(Joseph Landsberg) 2015-08-11 2015 KAIST CMC Lecture Series by Joseph Landsberg - Generalizations of Strassen's equations. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8018&ko_name=Landsberg%2C+Joseph+M.+&paper_id=(Joseph Landsberg) 2015-08-11 2015 ASARC - Constructions of k-regular maps using finite local schemes (Jaroslaw Buczynski ) 2015-08-11 2015 KAIST CMC Lecture Series by Joseph Landsberg - Strassen's algorithm and the astounding conjecture http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8018&ko_name=Landsberg%2C+Joseph+M.+&paper_id=(Joseph Landsberg ) 2015-08-10 2015 KAIST CMC Lecture Series by Joseph Landsberg - Strassen's equations: from linear to multi-linear algebra http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8018&ko_name=Landsberg%2C+Joseph+M.+&paper_id=(Joseph Landsberg) 2015-08-10 2015 CMC (Foundations for Mathematical Challenges) - Well-posedness theory for the Navier-Stokes equations IX http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4091&ko_name=%EA%B9%80%ED%98%84%EC%84%9D&paper_id=&key_name=%EA%B9%80%ED%98%84%EC%84%9D&key_locale=in( ) 2015-08-07 2015 CMC (Foundations for Mathematical Challenges) - Well-posedness theory for the Navier-Stokes equations X http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4091&ko_name=%EA%B9%80%ED%98%84%EC%84%9D&paper_id=&key_name=%EA%B9%80%ED%98%84%EC%84%9D&key_locale=in( ) 2015-08-07 2015 CMC (Foundations for Mathematical Challenges) - Well-posedness theory for the Navier-Stokes equations VII http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4091&ko_name=%EA%B9%80%ED%98%84%EC%84%9D&paper_id=&key_name=%EA%B9%80%ED%98%84%EC%84%9D&key_locale=in( ) 2015-08-06 2015 CMC (Foundations for Mathematical Challenges) - Well-posedness theory for the Navier-Stokes equations VIII http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4091&ko_name=%EA%B9%80%ED%98%84%EC%84%9D&paper_id=&key_name=%EA%B9%80%ED%98%84%EC%84%9D&key_locale=in( ) 2015-08-06 2015 Discrete Math - Graph dynamical systems: Some combinatorial problems related to Markov chains http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8017&ko_name=Wu%2C+Yaokun&paper_id=(Yaokun Wu) 2015-08-05 2015 Discrete Math - Big Math Data: possibilities and challenges http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8016&ko_name=Wang%2C+Jinfang&paper_id=(Jinfang Wang) 2015-08-05 2015 CMC (Foundations for Mathematical Challenges) - Well-posedness theory for the Navier-Stokes equations V http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4091&ko_name=%EA%B9%80%ED%98%84%EC%84%9D&paper_id=&key_name=%EA%B9%80%ED%98%84%EC%84%9D&key_locale=in( ) 2015-08-05 2015 CMC (Foundations for Mathematical Challenges) - Well-posedness theory for the Navier-Stokes equations VI http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4091&ko_name=%EA%B9%80%ED%98%84%EC%84%9D&paper_id=&key_name=%EA%B9%80%ED%98%84%EC%84%9D&key_locale=in( ) 2015-08-05 2015 CMC (Foundations for Mathematical Challenges) - Well-posedness theory for the Navier-Stokes equations III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4091&ko_name=%EA%B9%80%ED%98%84%EC%84%9D&paper_id=&key_name=%EA%B9%80%ED%98%84%EC%84%9D&key_locale=in( ) 2015-08-04 2015 CMC (Foundations for Mathematical Challenges) - Well-posedness theory for the Navier-Stokes equations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4091&ko_name=%EA%B9%80%ED%98%84%EC%84%9D&paper_id=&key_name=%EA%B9%80%ED%98%84%EC%84%9D&key_locale=in( ) 2015-08-04 2015 CMC (Foundations for Mathematical Challenges) - Well-posedness theory for the Navier-Stokes equations I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4091&ko_name=%EA%B9%80%ED%98%84%EC%84%9D&paper_id=&key_name=%EA%B9%80%ED%98%84%EC%84%9D&key_locale=in( ) 2015-08-03 2015 CMC (Foundations for Mathematical Challenges) - Well-posedness theory for the Navier-Stokes equations II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4091&ko_name=%EA%B9%80%ED%98%84%EC%84%9D&paper_id=&key_name=%EA%B9%80%ED%98%84%EC%84%9D&key_locale=in( ) 2015-08-03 2015 KMRS Syzygy seminar - Kindergarten syzygies http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Bernd Sturmfelds) 2015-07-28 2015 KMRS - Graph Polynomials - Lecture 3: Hankel matrices and Graph Polynomials. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8013&ko_name=Makowsky%2C+Johann+Andreas+&paper_id=(Johann Makowsky) 2015-07-22 2015 KMRS - Graph Polynomials - Lecture 2-1: Why is the Chromatic Polynomial a Polynomial? http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8013&ko_name=Makowsky%2C+Johann+Andreas+&paper_id=(Johann Makowsky) 2015-07-21 2015 KMRS - Graph Polynomials - Lecture 2-2: Why is the Chromatic Polynomial a Polynomial? http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8013&ko_name=Makowsky%2C+Johann+Andreas+&paper_id=(Johann Makowsky) 2015-07-21 2015 KMRS - Graph Polynomials - Lecture 1: A Landscape of Graph Polynomials. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8013&ko_name=Makowsky%2C+Johann+Andreas+&paper_id=(Johann Makowsky) 2015-07-20 2015 Discrete Math - Approximately Counting H-Colorings is #BIS-Hard (Andreas Galanis) 2015-07-13 2015 KAIST CMC Mathematical Biology Conference on Cross-Diffusion, Chemotaxis, and Related Problems - Some recent results for cross diffusion equations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8007&ko_name=Desvillettes%2C+Laurent&paper_id=(Laurent Desvillettes ) 201507-10 2015 KAIST CMC Mathematical Biology Conference on Cross-Diffusion, Chemotaxis, and Related Problems - A linear finite volume method for nonlinear cross-diffusion systems http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8010&ko_name=Murakawa%2C+Hideki&paper_id=(Hideki Murakawa ) 2015-07-10 2015 KAIST CMC Mathematical Biology Conference on Cross-Diffusion, Chemotaxis, and Related Problems - Traveling Waves and Steady States for S-K-T Competition Model with Cross-Diffusion http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8009&ko_name=Wu%2C+Yaping&paper_id=(Yaping Wu ) 2015-07-10 2015 KAIST CMC Mathematical Biology Conference on Cross-Diffusion, Chemotaxis, and Related Problems - The effects of starvation driven diffusion on the dynamics of populations (Ohsang Kwon ) 2015-07-10 2015 KAIST CMC Mathematical Biology Conference on Cross-Diffusion, Chemotaxis, and Related Problems - Slowing Allee effect vs accelerating heavy tails in population dynamics models http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8008&ko_name=Alfaro%2C+Matthieu&paper_id= (Matthieu Alfaro) 2015-07-10 2015 KAIST CMC Mathematical Biology Conference on Cross-Diffusion, Chemotaxis, and Related Problems - Global existence and Finite time blow-up of a parabolic-ODE type Keller-Segel system (Jaewook Ahn ) 2015-07-10 2015 KAIST CMC Mathematical Biology Conference on Cross-Diffusion, Chemotaxis, and Related Problems - Bistable nonlinearity having a discontinuity (Jaywan Chung ) 2015-07-10 2015 KAIST CMC Mathematical Biology Conference on Cross-Diffusion, Chemotaxis, and Related Problems - Dynamics of solutions for chemotaxis-growth systems http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5138&ko_name=Ei%2C+Shin-Ichiro&paper_id=(Shin-Ichiro Ei ) 2015-0709 2015 KAIST CMC Mathematical Biology Conference on Cross-Diffusion, Chemotaxis, and Related Problems - Pattern formation in chemotaxis-growth systems http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8011&ko_name=Izuhara%2C+Hirofumi+&paper_id=(Hirofumi Izuhara) 201507-09 2015 KAIST CMC Mathematical Biology Conference on Cross-Diffusion, Chemotaxis, and Related Problems - On time evolution problem for E-coli colonies (Danielle Hilhorst) 2015-07-09 2015 KAIST CMC Mathematical Biology Conference on Cross-Diffusion, Chemotaxis, and Related Problems - On regularity for the Chemotaxis-Navier-Stokes Equations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4178&ko_name=%EA%B0%95%EA%B2%BD%EA%B7%BC&paper_id=&key_pos=%EC%97%B0%EC%84%B8%EB%8C%80%ED%95%99%EA%B5%90&key_locale=in(Kyungkeun Kang) 2015-07-09 2015 KAIST CMC Mathematical Biology Conference on Cross-Diffusion, Chemotaxis, and Related Problems - The role of chemotaxis and diffusion processes in tumor growth models http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4930&ko_name=%EA%B9%80%EC%96%91%EC%A7%84&paper_id=&key_pos=%EA%B1%B4%EA%B5%AD%EB%8C%80%ED%95%99%EA%B5%90&key_locale=in(Yangjin Kim ) 2015-07-09 2015 KAIST CMC Mathematical Biology Conference on Cross-Diffusion, Chemotaxis, and Related Problems - Cell aggregation without gradient-sensing (Changwook Yoon) 2015-07-09 2015 KAIST CMC Mathematical Biology Conference on Cross-Diffusion, Chemotaxis, and Related Problems - Two-dimensional traveling waves in a three-species competition-diffusion system (Lorenzo Contento) 2015-07-09 2015 KAIST CMC Mathematical Biology Conference on Cross-Diffusion, Chemotaxis, and Related Problems - The Effect of Starvation Driven Diffusion in a Prey-Predator Model (Dohyun Kwon ) 2015-07-09 2015 KAIST CMC Mathematical Biology Conference on Cross-Diffusion, Chemotaxis, and Related Problems - On some nonlocal problems http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8014&ko_name=Chipot%2C+Michel&paper_id=(Michel Chipot) 2015-07-08 2015 KAIST CMC Mathematical Biology Conference on Cross-Diffusion, Chemotaxis, and Related Problems - A nonlocal system modelling the spread of epidemics on networks http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8015&ko_name=Logak%2C+Elisabeth&paper_id=(Eliabeth Logak) 2015-07-08 2015 KAIST CMC Mathematical Biology Conference on Cross-Diffusion, Chemotaxis, and Related Problems - NONLOCAL EFFECTS IN SOME MATHEMATICAL MODELS FROM BIOLOGY (Fang Li ) 2015-07-08 2015 KAIST CMC Mathematical Biology Conference on Cross-Diffusion, Chemotaxis, and Related Problems - Self-similar solutions for a thin film Muskat problem http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8012&ko_name=Lauren%C3%A7ot%2C+Philippe&paper_id=(Philippe Laurencot ) 2015-07-08 2015 KAIST CMC Mathematical Biology Conference on Cross-Diffusion, Chemotaxis, and Related Problems - Diffusion with non-constant steady states http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4112&ko_name=%EA%B9%80%EC%9A%A9%EC%A0%95&paper_id=&key_name=%EA%B9%80%EC%9A%A9%EC%A0%95&key_locale=in(Yong Jung Kim) 2015-07-08 2015 KAIST CMC Mathematical Biology Conference on Cross-Diffusion, Chemotaxis, and Related Problems - Macroscopic Convergence of a Microscopic Kinetic Model to Starvation Driven Di ffusion (Beomjun Choi) 2015-07-08 2015 KAIST CMC Mathematical Biology Conference on Cross-Diffusion, Chemotaxis, and Related Problems - A chemotaxis model with metric of food (Sun-Ho Choi) 2015-07-08 2015 Discrete Math - Partitions associated with three third order mock theta functions http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3323&ko_name=%EC%9D%B4%EC%95%A0%EC%9E%90&paper_id=Yee&key_name=%EC%9D%B4%EC%95%A0%EC%9E%90&key_locale=in( ) 2015-06-23 2015 KAIST Math. Colloquium - Algebraic K-theory and arithmetic http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7998&ko_name=de+Jeu%2C+Rob&paper_id=(Rob de Jeu) 2015-06-11 2015 Discrete Math - A Simple Algorithm for Sampling Colourings of G(n, d/n) Up to Gibbs Uniqueness Threshold http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7999&ko_name=Efthymiou%2C+Charilaos+&paper_id=(Charilaos Efthymiou ) 2015-06-10 2015 Discrete Math - Space Proof Complexity for Random 3-CNFs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8000&ko_name=Huynh%2C+Tony+&paper_id=(Tony Huynh ) 2015-06-02 2015 KAIST CMC Lecture Series - Odd ramification coverings and theta characteristic on a complex curve http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4768&ko_name=Gian+Pietro+Pirola&paper_id=(Gian Pietro Pirola) 2015-05-27 2015 Fudan - Kaist Workshop on Algebra and Geometry - Finiteness of some 2-dimensional Galois represntations over totally real fields http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4323&ko_name=%EC%B5%9C%EC%84%9C%ED%98%84&paper_id=&key_name=%EC%B5%9C%EC%84%9C%ED%98%84&key_locale=in(Suh Hyun CHOI) 2015-05-23 2015 Fudan - Kaist Workshop on Algebra and Geometry - The geometry of tempered dual of special linear group http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7997&ko_name=Chao%2C+Kuok+Fai&paper_id=(Kuok Fai CHAO) 2015-05-23 2015 Fudan - Kaist Workshop on Algebra and Geometry - Symplectic capacities from Hamiltonian circle actions http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=742&ko_name=%EC%84%9C%EB%8F%99%EC%97%BD&paper_id=&key_name=%EC%84%9C%EB%8F%99%EC%97%BD&key_locale=in(Dong Youp SUH) 2015-05-22 2015 Fudan - Kaist Workshop on Algebra and Geometry - Equivariant unitary bordism and equivariant cohomology Chern numbers http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4691&ko_name=Zhi+Lu&paper_id=(Zhi LU) 2015-05-22 2015 Fudan - Kaist Workshop on Algebra and Geometry - Poisson (co)homology over smooth Poisson varieties http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7995&ko_name=Wu%2C+Quanshui&paper_id=(Quanshui WU) 2015-05-21 2015 Fudan - Kaist Workshop on Algebra and Geometry - On algebraic cobordism version of Grothendieck standard conjecture D. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4295&ko_name=%EB%B0%95%EC%A7%84%ED%98%84&paper_id=&key_name=%EB%B0%95%EC%A7%84%ED%98%84&key_locale=in(Jinhyun PARK) 2015-05-21 2015 Fudan - Kaist Workshop on Algebra and Geometry - Solvability of the Dirac equation and geometric applications http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7996&ko_name=Ji%2C+Qingchun&paper_id=(Qingchun JI) 2015-05-21 2015 Fudan - Kaist Workshop on Algebra and Geometry - Semi-decomposable cohomological invariants of degree 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4820&ko_name=%EB%B0%B1%EC%83%81%ED%9B%88&paper_id=&key_name=%EB%B0%B1%EC%83%81%ED%9B%88&key_locale=in(Sanghoon BAEK) 2015-05-21 2015 Fudan - Kaist Workshop on Algebra and Geometry - Gosset Polytopes on blown-up Hirzebruch surfaces (YongJoo SHIN) 2015-05-21 2015 Fudan - Kaist Workshop on Algebra and Geometry - Weakly exceptional weighted Fano complete intersection (Joonyeong WON) 2015-05-21 2015 KAIST CMC Lecture Series - On the semiample cone of the two symmetric product of a curve http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4768&ko_name=Gian+Pietro+Pirola&paper_id=(Gian Pietro Pirola) 2015-05-20 2015 Discrete Math - Optimal Competitive Auctions http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7994&ko_name=Liu%2C+Pinyan&paper_id=(Pinyan Lu) 2015-05-19 2015 KAIST Math. Colloquium - To be rational, or not to be. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3735&ko_name=%EB%B0%95%EC%A7%80%ED%9B%88&paper_id=&key_name=%EB%B0%95%EC%A7%80%ED%9B%88&key_locale=in( ) 2015-05-14 2015 Discrete Math - Stable Matching in Large Economies ( ) 2015-05-12 2015 KAIST Math. Colloquium - Counting functions and Mock (Quantum) Modular Forms http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4695&ko_name=%EA%B9%80%EB%B3%91%EC%B0%AC&paper_id=&key_name=%EA%B9%80%EB%B3%91%EC%B0%AC&key_locale=in( ) 2015-05-07 2015 Lecture Series - Geometric applications of generic ideals and their combinatiorial aspect IV http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3706&ko_name=%EC%95%88%EC%9E%AC%EB%A7%8C&paper_id=&key_name=%EC%95%88%EC%9E%AC%EB%A7%8C&key_locale=in( ) 2015-04-28 2015 Lecture Series - Geometric applications of generic ideals and their combinatiorial aspect III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3706&ko_name=%EC%95%88%EC%9E%AC%EB%A7%8C&paper_id=&key_name=%EC%95%88%EC%9E%AC%EB%A7%8C&key_locale=in( ) 2015-04-27 2015 Advanced School on Algebric Geometry - On the Minimal Model Programme III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4390&ko_name=Paolo+Cascini&paper_id=(Paolo Cascini ) 2015-04-23 2015 Advanced School on Algebric Geometry - Direct images of pluricanonical divisors III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4292&ko_name=Osamu+Fujino&paper_id=(Osamu Fujino) 2015-04-23 2015 Advanced School on Algebric Geometry - Dual complex of a pair III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7990&ko_name=Xu%2C+Chenyang&paper_id=(Chenyang Xu) 2015-04-23 2015 Advanced School on Algebric Geometry - Mori theory and toric geometry III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4388&ko_name=James+McKernan&paper_id=(James McKernan) 2015-04-23 2015 Advanced School on Algebric Geometry - Dual complex of a pair II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7990&ko_name=Xu%2C+Chenyang&paper_id=(Chenyang Xu) 2015-04-22 2015 Advanced School on Algebric Geometry - Mori theory and toric geometry II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4388&ko_name=James+McKernan&paper_id=(James McKernan) 2015-04-22 2015 Advanced School on Algebric Geometry - On the Minimal Model Programme II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4390&ko_name=Paolo+Cascini&paper_id=(Paolo Cascini ) 2015-04-21 2015 Advanced School on Algebric Geometry - Direct images of pluricanonical divisors II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4292&ko_name=Osamu+Fujino&paper_id=(Osamu Fujino) 2015-04-21 2015 Advanced School on Algebric Geometry - Applications of the projective geometry of the variety of minimal rational tangents (Hosung Kim) 2015-04-21 2015 Advanced School on Algebric Geometry - Potentially non-klt locus and its applications (Jinhyung Park ) 2015-04-21 2015 Advanced School on Algebric Geometry - General polarizations of del Pezzo surfaces (Joonyeong Won ) 2015-04-21 2015 Lecture Series - Lectures on Equivariant Symplectic Geometry II ( ) 2015-04-20 2015 Lecture Series - Lectures on Equivariant Symplectic Geometry III ( ) 2015-04-20 2015 Lecture Series - Lectures on Equivariant Symplectic Geometry IV ( ) 2015-04-20 2015 Advanced School on Algebric Geometry - On the Minimal Model Programme I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4390&ko_name=Paolo+Cascini&paper_id=(Paolo Cascini ) 2015-04-20 2015 Advanced School on Algebric Geometry - Direct images of pluricanonical divisors I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4292&ko_name=Osamu+Fujino&paper_id=(Osamu Fujino) 2015-04-20 2015 Advanced School on Algebric Geometry - Dual complex of a pair I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7990&ko_name=Xu%2C+Chenyang&paper_id=(Chenyang Xu) 2015-04-20 2015 Advanced School on Algebric Geometry - Mori theory and toric geometry I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4388&ko_name=James+McKernan&paper_id=(James McKernan) 2015-04-20 2015 Pre- School on Algebric Geometry - Algebraic Surfaces in view of Minimal Model Program II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4773&ko_name=%ED%99%A9%EB%8F%99%EC%84%A0&paper_id=&key_name=%ED%99%A9%EB%8F%99&key_locale=in(DongSeon Hwang) 2015-04-18 2015 Pre- School on Algebric Geometry - Running the minimal model program II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=7993&ko_name=%EC%B5%9C%EC%84%B1%EB%9D%BD&paper_id=&key_name=%EC%B5%9C%EC%84%B1%EB%9D%BD&key_locale=in(Sung Rak Choi) 2015-04-18 2015 Pre- School on Algebric Geometry - Birational geometry of Mori fibrations III (Takuzo Okada) 2015-04-18 2015 Pre- School on Algebric Geometry - Running the minimal model program III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=7993&ko_name=%EC%B5%9C%EC%84%B1%EB%9D%BD&paper_id=&key_name=%EC%B5%9C%EC%84%B1%EB%9D%BD&key_locale=in(Sung Rak Choi) 2015-04-18 2015 Pre- School on Algebric Geometry - Algebraic Surfaces in view of Minimal Model Program III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4773&ko_name=%ED%99%A9%EB%8F%99%EC%84%A0&paper_id=&key_name=%ED%99%A9%EB%8F%99&key_locale=in(DongSeon Hwang) 2015-04-18 2015 Pre- School on Algebric Geometry - Birational geometry of Mori fibrations I (Takuzo Okada) 2015-04-17 2015 Pre- School on Algebric Geometry - Algebraic Surfaces in view of Minimal Model Program I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4773&ko_name=%ED%99%A9%EB%8F%99%EC%84%A0&paper_id=&key_name=%ED%99%A9%EB%8F%99&key_locale=in(DongSeon Hwang) 2015-04-17 2015 Lecture Series - Lectures on Equivariant Symplectic Geometry ( ) 2015-04-17 2015 Lecture Series - Lectures on Equivariant Symplectic Geometry ( ) 2015-04-17 2015 Lecture Series - Lectures on Equivariant Symplectic Geometry I ( ) 2015-04-17 2015 Pre- School on Algebric Geometry - Running the minimal model program I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=7993&ko_name=%EC%B5%9C%EC%84%B1%EB%9D%BD&paper_id=&key_name=%EC%B5%9C%EC%84%B1%EB%9D%BD&key_locale=in(Sung Rak Choi) 2015-04-17 2015 Pre- School on Algebric Geometry - Birational geometry of Mori fibrations II (Takuzo Okada) 2015-04-17 2015 KAIST Math. Colloquium - IT - ( ) 2015-04-16 2015 Discrete Math - Computational Phase Transitions for the Potts Model http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4470&ko_name=Eric+Vigoda&paper_id=(Eric Vigoda) 2015-04-14 2015 Lecture Series - Lectures on Equivariant Symplectic Geometry VI ( ) 2015-04-13 2015 Lecture Series - Lectures on Equivariant Symplectic Geometry VII ( ) 2015-04-13 2015 Lecture Series - Lectures on Equivariant Symplectic Geometry VIII ( ) 2015-04-13 2015 Lecture Series - Lectures on Equivariant Symplectic Geometry III ( ) 2015-04-10 2015 Lecture Series - Lectures on Equivariant Symplectic Geometry IV ( ) 2015-04-10 2015 Lecture Series - Lectures on Equivariant Symplectic Geometry V ( ) 2015-04-10 2015 Lecture Series - Overlapping Schwarz Methods http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4982&ko_name=%EC%A1%B0%EB%8D%95%EB%B9%88&paper_id=&key_name=%EC%A1%B0%EB%8D%95%EB%B9%88&key_locale=in( ) 2015-0410 2015 Lecture Series - An Introduction to Non-overlapping Domain Decomposition Methods ( ) 2015-04-10 2015 KAIST Math. Colloquium - Combinatorics of orthogonal polynomials ( ) 2015-04-09 2015 Lecture Series - Introduction to Torus Equivariant Cohomology VII http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=6420&ko_name=Kuroki%2C+Shintar%C3%B4&paper_id=(Shintaro Kuroki ) 2015-04-08 2015 Lecture Series - Introduction to Torus Equivariant Cohomology VI http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=6420&ko_name=Kuroki%2C+Shintar%C3%B4&paper_id=(Shintaro Kuroki ) 2015-04-07 2015 Discrete Math - Topological methods in matching theory (Andreas Holmsen) 2015-04-07 2015 Lecture Series - Introduction to Torus Equivariant Cohomology V http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=6420&ko_name=Kuroki%2C+Shintar%C3%B4&paper_id=(Shintaro Kuroki ) 2015-04-06 2015 Lecture Series - Lectures on Equivariant Symplectic Geometry I ( ) 2015-04-06 2015 Lecture Series - Lectures on Equivariant Symplectic Geometry II ( ) 2015-04-06 2015 Lecture Series - Geometric applications of generic ideals and their combinatiorial aspect II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3706&ko_name=%EC%95%88%EC%9E%AC%EB%A7%8C&paper_id=&key_name=%EC%95%88%EC%9E%AC%EB%A7%8C&key_locale=in( ) 2015-04-06 2015 KAIST CMC Lecture Series - Potentials of Kaehler forms on Teichmuller spaces of punctured spheres http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3761&ko_name=%EB%B0%95%EC%A7%84%EC%84%B1&paper_id=&key_name=%EB%B0%95%EC%A7%84%EC%84%B1&key_locale=in( ) 2015-04-03 2015 Lecture Series - Introduction to Torus Equivariant Cohomology IV http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=6420&ko_name=Kuroki%2C+Shintar%C3%B4&paper_id=(Shintaro Kuroki ) 2015-04-02 2015 Lecture Series - Introduction to Torus Equivariant Cohomology III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=6420&ko_name=Kuroki%2C+Shintar%C3%B4&paper_id=(Shintaro Kuroki ) 2015-04-01 2015 Lecture Series - Introduction to Torus Equivariant Cohomology II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=6420&ko_name=Kuroki%2C+Shintar%C3%B4&paper_id=(Shintaro Kuroki ) 2015-03-31 2015 Lecture Series - A bound for Castelnuovo-Mumford regularity of curves II ( ) 2015-03-31 2015 Lecture Series - Introduction to Torus Equivariant Cohomology I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=6420&ko_name=Kuroki%2C+Shintar%C3%B4&paper_id=(Shintaro Kuroki ) 2015-03-30 2015 Lecture Series - A bound for Castelnuovo-Mumford regularity of curves I ( ) 2015-03-30 2015 Lecture Series - Hilbert funtions, Betti tables and computation VI http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5089&ko_name=%ED%95%9C%EA%B0%95%EC%A7%84&paper_id=&key_name=%ED%95%9C%EA%B0%95%EC%A7%84&key_locale=in( ) 2015-03-28 2015 Lecture Series - Geometric applications of generic ideals and their combinatiorial aspect I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3706&ko_name=%EC%95%88%EC%9E%AC%EB%A7%8C&paper_id=&key_name=%EC%95%88%EC%9E%AC%EB%A7%8C&key_locale=in( ) 2015-03-28 2015 Lecture Series - Hilbert funtions, Betti tables and computation V http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5089&ko_name=%ED%95%9C%EA%B0%95%EC%A7%84&paper_id=&key_name=%ED%95%9C%EA%B0%95%EC%A7%84&key_locale=in( ) 2015-03-27 2015 KAIST Math. Colloquium - ( ) 2015-03-26 2015 Lecture Series - Hilbert funtions, Betti tables and computation IV http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5089&ko_name=%ED%95%9C%EA%B0%95%EC%A7%84&paper_id=&key_name=%ED%95%9C%EA%B0%95%EC%A7%84&key_locale=in( ) 2015-03-21 2015 Lecture Series - I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4121&ko_name=%EC%A0%84%EC%9D%B8%ED%83%9C&paper_id=&key_name=%EC%A0%84%EC%9D%B8%ED%83%9C&key_locale=in( ) 2015-03-20 2015 Lecture Series - II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4121&ko_name=%EC%A0%84%EC%9D%B8%ED%83%9C&paper_id=&key_name=%EC%A0%84%EC%9D%B8%ED%83%9C&key_locale=in( ) 2015-03-20 2015 Lecture Series - III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4121&ko_name=%EC%A0%84%EC%9D%B8%ED%83%9C&paper_id=&key_name=%EC%A0%84%EC%9D%B8%ED%83%9C&key_locale=in( ) 2015-03-20 2015 Lecture Series - Hilbert funtions, Betti tables and computation III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5089&ko_name=%ED%95%9C%EA%B0%95%EC%A7%84&paper_id=&key_name=%ED%95%9C%EA%B0%95%EC%A7%84&key_locale=in( ) 2015-03-20 2015 Discrete Math - Tree-cut width: computation and algorithmic applications ( ) 2015-03-17 2015 KAIST CMC Lecture Series - Lectures on Teichmueller Dynamics, III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7987&ko_name=Chen%2C+Dawei&paper_id=(Dawei Chen) 2015-03-16 2015 KAIST CMC Lecture Series - Lectures on Teichmueller Dynamics, IV http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7987&ko_name=Chen%2C+Dawei&paper_id=(Dawei Chen) 2015-03-16 2015 Lecture Series - Hilbert funtions, Betti tables and computation II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5089&ko_name=%ED%95%9C%EA%B0%95%EC%A7%84&paper_id=&key_name=%ED%95%9C%EA%B0%95%EC%A7%84&key_locale=in( ) 2015-03-14 2015 Lecture Series - Several cases where physics constrains computation, Several cases where computation constrains physics http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=1809&ko_name=%EC%A7%80%EB%8F%99%ED%91%9C&paper_id=&key_name=%EC%A7%80%EB%8F%99%ED%91%9C&key_locale=in( ) 2015-03-13 2015 Lecture Series - Information, entropy and all that http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1809&ko_name=%EC%A7%80%EB%8F%99%ED%91%9C&paper_id=&key_name=%EC%A7%80%EB%8F%99%ED%91%9C&key_locale=in( ) 2015-03-13 2015 Lecture Series - Quantum helps classical http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1809&ko_name=%EC%A7%80%EB%8F%99%ED%91%9C&paper_id=&key_name=%EC%A7%80%EB%8F%99%ED%91%9C&key_locale=in( ) 2015-03-13 2015 Lecture Series - Hilbert funtions, Betti tables and computation I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5089&ko_name=%ED%95%9C%EA%B0%95%EC%A7%84&paper_id=&key_name=%ED%95%9C%EA%B0%95%EC%A7%84&key_locale=in( ) 2015-03-13 2015 KAIST Math. Colloquium - ( ) 2015-03-12 2015 KAIST CMC Lecture Series - Lectures on Teichmueller Dynamics, I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7987&ko_name=Chen%2C+Dawei&paper_id=(Dawei Chen) 2015-03-11 2015 KAIST CMC Lecture Series - Lectures on Teichmueller Dynamics, II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7987&ko_name=Chen%2C+Dawei&paper_id=(Dawei Chen) 2015-03-11 2015 KAIST Math. Colloquium - Introduction to Cluster Algebras ( ) 2015-03-05 2015 Lecture Series - I ( ) 2015-03-02 2015 Lecture Series - II ( ) 2015-03-02 2015 KAIST Special Lecture Series - An introduction to Gromov-Witten invariants and quantum cohomology lecture 4 (Taekgyu Hwang) 2015-02-13 2015 KAIST Special Lecture Series - An introduction to Gromov-Witten invariants and quantum cohomology lecture 3 (Taekgyu Hwang) 2015-02-12 2015 KAIST Special Lecture Series - An introduction to Gromov-Witten invariants and quantum cohomology lecture 2 (Taekgyu Hwang) 2015-02-10 2015 KAIST Special Lecture Series - An introduction to Gromov-Witten invariants and quantum cohomology lecture 1 (Taekgyu Hwang) 2015-02-09 Back to top of page 2014 Discrete Math - Spectral radius and fractional matchings ( ) 2014-12-23 2014 ASARC - Syzygies and degeneration techniques IV http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4414&ko_name=Marian+Aprodu&paper_id=(Marian Aprodu ) 2014-12-19 2014 ASARC - Syzygies and degeneration techniques III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4414&ko_name=Marian+Aprodu&paper_id=(Marian Aprodu) 2014-12-18 2014 KAIST CMC Annual Distinguished Lecture - Theory of excluding induced subgraphs Lecture 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4453&ko_name=Paul+Seymour&paper_id=(Paul Seymour) 2014-12-12 2014 KAIST CMC Annual Distinguished Lecture - Theory of excluding induced subgraphs Lecture 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4454&ko_name=Maria+Chudnovsky&paper_id=(Maria Chudnovsky) 2014-12-12 2014 KAIST CMC Discreth Math Workshop - Planar graph emulators – Beyond planarity in the plane (Petr Hliněný) 2014-12-12 2014 KMRS - Cohomological invariants of algebraic groups III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7818&ko_name=Merkurjev%2C+Alexander&paper_id=(Alexander Merkurjev) 2014-12-12 2014 KAIST CMC Annual Distinguished Lecture - Theory of excluding induced subgraphs Lecture 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4453&ko_name=Paul+Seymour&paper_id=(Paul Seymour) 2014-12-11 2014 KAIST CMC Annual Distinguished Lecture - Theory of excluding induced subgraphs Lecture 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4454&ko_name=Maria+Chudnovsky&paper_id=(Maria Chudnovsky) 2014-12-11 2014 KAIST CMC Discreth Math Workshop - The Betti numbers of real toric varieties corresponding to generalized graph associahedra http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4471&ko_name=%EC%B5%9C%EC%88%98%EC%98%81&paper_id=&key_name=%EC%B5%9C%EC%88%98%EC%98%81&key_locale=in(Suyoung Choi) 2014-12-11 2014 KAIST CMC Discreth Math Workshop - Regular subgraphs in uniform hypergraphs (Jaehoon Kim) 2014-12-11 2014 KAIST CMC Discreth Math Workshop - On choosability with separation of planar graphs with forbidden cycles (Ilkyoo Choi) 2014-12-11 2014 KAIST Math. Colloquium - Essential dimension in algebra http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7818&ko_name=Merkurjev%2C+Alexander&paper_id=(Alexander Merkurjev ) 2014-12-11 2014 KMRS - Cohomological invariants of algebraic groups II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7818&ko_name=Merkurjev%2C+Alexander&paper_id=(Alexander Merkurjev) 2014-12-10 2014 KAIST CMC Discreth Math Workshop - A variation of list coloring and its properties http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3661&ko_name=%EA%B6%8C%EC%98%81%EC%88%98&paper_id=&key_name=%EA%B6%8C%EC%98%81%EC%88%98&key_locale=in(Young Soo Kwon ) 2014-12-10 2014 KAIST CMC Discreth Math Workshop - Small topics on association schemes (Mitsugu Hirasaka) 2014-12-10 2014 KAIST CMC Discreth Math Workshop - On Extremal Combinatorial Problems of Noga Alon (Younjin Kim ) 2014-12-10 2014 KAIST CMC Discreth Math Workshop - A new q-Selberg integral, Schur functions, and Young books (Jang Soo Kim) 2014-12-10 2014 KMRS - Cohomological invariants of algebraic groups I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7818&ko_name=Merkurjev%2C+Alexander&paper_id=(Alexander Merkurjev) 2014-12-09 Discrete Math - Matroid Optimization http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7819&ko_name=Lee%2C+Jon&paper_id=(Jon Lee) 2014-12-04 2014 SNU ( : ) - Gromov-Witten-Floer theory and Lagrangian intersections in symplectic topology ( ) 2014-12-04 2 - Mid-mantle interaction between the big, active Samoan plume and the Tonga slab ( ) 2014-12-04 Discrete Math - Upper bounds on the size of obstructions for graphs of linear rank-width at most k ( ) 2014-12-02 2 - 55 - ( ) 2014-11-28 Discrete Math - Enumeration of symmetric hex trees and the related polynomials ( ) 2014-11-25 Discrete Math - Generalized Davenport-Schinzel Sequences: Regaining Linearity http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7817&ko_name=Wilkinson%2C+Bryan+T.&paper_id=(Bryan Wilkinson) 2014-11-18 2 - Energy Frontier Research in Extreme Environments ( ) 2014-11-18 2014 KAIST Math. Colloquium - Oriented equivariant cohomology, formal group laws and generalized Schubert calculus http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7816&ko_name=Zainoulline%2C+Kirill&paper_id=(Kirill Zainoulline) 2014-11-13 2 - ( ) 2014-11-07 Discrete Math - The topology of restricted partition posets http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7815&ko_name=%EC%A0%95%EC%A7%80%EC%9C%A4&paper_id=&key_name=%EC%A0%95%EC%A7%80%EC%9C%A4&key_locale=in( ) 2014-11-04 KAIST CMC Intensive Lecture - Geometry of webs of rational curves http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2086&ko_name=%ED%99%A9%EC%A4%80%EB%AC%B5&paper_id=&key_name=%ED%99%A9%EC%A4%80%EB%AC%B5&key_locale=in( ) 201410-31 2014 KAIST Math. Colloquium - Proper holomorphic maps between bounded symmetric domains http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=77&ko_name=%EA%B9%80%EC%84%B1%EC%97%B0&paper_id=&key_name=%EA%B9%80%EC%84%B1%EC%97%B0&key_locale=in( ) 2014-10-30 2014 KAIST Special Lecture Series - II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=742&ko_name=%EC%84%9C%EB%8F%99%EC%97%BD&paper_id=&key_name=%EC%84%9C%EB%8F%99%EC%97%BD&key_locale=in( ) 2014-10-29 Discrete Math - On the enumeration of minimal transversals (Mamadou Moustapha Kanté) 2014-10-28 2014 KAIST Special Lecture Series - I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=742&ko_name=%EC%84%9C%EB%8F%99%EC%97%BD&paper_id=&key_name=%EC%84%9C%EB%8F%99%EC%97%BD&key_locale=in( ) 2014-10-27 2014 KAIST Math. Colloquium - On the large time behavior of the solutions of a nonlocal ordinary differential equation http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7814&ko_name=Hilhorst%2C+Danielle&paper_id=(Danielle Hilhorst ) 2014-10-16 Discrete Math - Ehrhart polynomials and Eulerian statistic on permutations (Matthieu Josuat-Verges ) 2014-10-14 Discrete Math - Enumeration of multiple self-avoiding polygons in a confined square lattice http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3945&ko_name=%EC%98%A4%EC%8A%B9%EC%83%81&paper_id=&key_name=%EC%98%A4%EC%8A%B9%EC%83%81&key_locale=in( ) 2014-10-07 KAIST CMC Intensive Lecture - Explicit Birational Geometry of Algebraic Threefolds, III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4709&ko_name=Meng+Chen&paper_id=(Meng Chen ) 2014-10-06 KAIST CMC Intensive Lecture - Explicit Birational Geometry of Algebraic Threefolds, IV http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4709&ko_name=Meng+Chen&paper_id=(Meng Chen ) 2014-10-06 2014 KAIST Math. Colloquium - On some Diophantine equations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2215&ko_name=%EA%B5%AC%EC%9E%90%EA%B2%BD&paper_id=&key_name=%EA%B5%AC%EC%9E%90%EA%B2%BD&key_locale=in( ) 201410-02 KAIST CMC Intensive Lecture - Explicit Birational Geometry of Algebraic Threefolds, I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4709&ko_name=Meng+Chen&paper_id=(Meng Chen ) 2014-10-01 KAIST CMC Intensive Lecture - Explicit Birational Geometry of Algebraic Threefolds, II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4709&ko_name=Meng+Chen&paper_id=(Meng Chen ) 2014-10-01 2014 KAIST Math. Colloquium - On the structure of very small product sets http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7388&ko_name=DeVos%2C+Matt&paper_id=(Matt DeVos) 2014-09-25 KAIST CMC Intensive Lecture by Matt DeVos - Additive Combinatorics; sumsets, sum-product problems, and graphs Lecture 4-1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7388&ko_name=DeVos%2C+Matt&paper_id=(Matt DeVos) 2014-09-23 KAIST CMC Intensive Lecture by Matt DeVos - Additive Combinatorics; sumsets, sum-product problems, and graphs Lecture 4-2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7388&ko_name=DeVos%2C+Matt&paper_id=(Matt DeVos) 2014-09-23 Workshop on Harmonic Analysis and Partial Differential Equations - Sharp spherically averaged Strichartz estimates for the Schrödinger equation http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7807&ko_name=Guo%2C+Zihua&paper_id=(Zihua Guo ) 2014-09-20 Workshop on Harmonic Analysis and Partial Differential Equations - Asymptotic behavior of relaxation shock waves http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=7808&ko_name=%EA%B6%8C%EB%B4%89%EC%84%9D&paper_id=&key_name=%EA%B6%8C%EB%B4%89%EC%84%9D&key_locale=in(Bongsuk Kwon ) 2014-09-20 Workshop on Harmonic Analysis and Partial Differential Equations - Stability of line solitons for the KP-II equation in R^2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7811&ko_name=Mizumachi%2C+Tetsu&paper_id=(Tetsu Mizumachi ) 2014-09-19 Workshop on Harmonic Analysis and Partial Differential Equations - Small data global existence and decay for Chern-Simons Higgs and Chern-Simons-Dirac equations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3909&ko_name=%EC%B1%84%EB%AA%85%EC%A3%BC&paper_id=&key_name=%EC%B1%84%EB%AA%85%EC%A3%BC&key_locale=in(Myeongju Chae) 2014-09-19 Workshop on Harmonic Analysis and Partial Differential Equations - Remarks on Chern-Simons equations in one space dimension http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4613&ko_name=%ED%97%88%ED%98%95%EC%A7%84&paper_id=&key_name=%ED%97%88%ED%98%95%EC%A7%84&key_locale=in(Hyungjin Huh ) 2014-09-19 Discrete Math - Bipartite graphs whose squares are not chromatic-choosable http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3837&ko_name=%EA%B9%80%EC%84%9D%EC%A7%84&paper_id=&key_name=%EA%B9%80%EC%84%9D%EC%A7%84&key_locale=in( ) 2014-09-19 Workshop on Harmonic Analysis and Partial Differential Equations - Restriction estimates for space curves with respect to general measures http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=7810&ko_name=%ED%95%A8%EC%84%B8%ED%98%84&paper_id=&key_name=%ED%95%A8%EC%84%B8%ED%98%84&key_locale=in(Seheon Ham ) 2014-09-19 Workshop on Harmonic Analysis and Partial Differential Equations - Global behavior of solutions to mass-subcritical NLS equations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7809&ko_name=Masaki%2C+Satoshi&paper_id=(Satoshi Masaki ) 2014-09-19 KAIST CMC Intensive Lecture by Matt DeVos - Additive Combinatorics; sumsets, sum-product problems, and graphs Lecture 3-1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7388&ko_name=DeVos%2C+Matt&paper_id=(Matt DeVos) 2014-09-18 KAIST CMC Intensive Lecture by Matt DeVos - Additive Combinatorics; sumsets, sum-product problems, and graphs Lecture 3-2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7388&ko_name=DeVos%2C+Matt&paper_id=(Matt DeVos) 2014-09-18 Workshop on Harmonic Analysis and Partial Differential Equations - Four-fermion interaction approximation of the intermediate vector boson model http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7813&ko_name=Tsutsumi%2C+Yoshio&paper_id=(Yoshio Tsutsumi ) 2014-09-18 Workshop on Harmonic Analysis and Partial Differential Equations - Vortex patches of Serfati (Hantaek Bae ) 2014-09-18 Workshop on Harmonic Analysis and Partial Differential Equations - Well-posedness and ill-posedness for the cubic fractional Schrödinger equations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=7812&ko_name=%ED%99%A9%EA%B2%BD%ED%95%98&paper_id=&key_name=%ED%99%A9%EA%B2%BD%ED%95%98&key_locale=in(Gyeongha Hwang) 2014-09-18 KAIST CMC Intensive Lecture by Matt DeVos - Additive Combinatorics; sumsets, sum-product problems, and graphs Lecture 2-1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7388&ko_name=DeVos%2C+Matt&paper_id=(Matt DeVos) 2014-09-16 KAIST CMC Intensive Lecture by Matt DeVos - Additive Combinatorics; sumsets, sum-product problems, and graphs Lecture 2-2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7388&ko_name=DeVos%2C+Matt&paper_id=(Matt DeVos) 2014-09-16 Discrete Math - Immersion in Graphs and Digraphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7388&ko_name=DeVos%2C+Matt&paper_id=(Matt DeVos) 2014-09-12 2014 KAIST Math. Colloquium - http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4232&ko_name=%EC%A1%B0%EC%B2%A0%ED%98%84&paper_id=&key_name=%EC%A1%B0%EC%B2%A0%ED%98%84&key_locale=in( ) 2014-09-11 Discrete Math - Some Advances in Sidorenko's Conjecture ( ) 2014-09-04 KAIST CMC Intensive Lecture by Matt DeVos - Additive Combinatorics; sumsets, sum-product problems, and graphs Lecture 1-2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7388&ko_name=DeVos%2C+Matt&paper_id=(Matt DeVos) 2014-09-02 KAIST CMC Intensive Lecture by Matt DeVos - Additive Combinatorics; sumsets, sum-product problems, and graphs Lecture 1-1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7388&ko_name=DeVos%2C+Matt&paper_id=(Matt DeVos) 2014-09-02 2014 KAIST-FUDAN Workshop on Analysis and Applied Mathematics - A quasi-interpolation scheme for periodic data based on multiquadric trigonometric B-splines (Wenwu Gao) 2014-08-28 2014 KAIST-FUDAN Workshop on Analysis and Applied Mathematics - Optimal Throughput and High Short Term Fairness Design of Renewal Access Protocol http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3816&ko_name=%ED%99%A9%EA%B0%95%EC%9A%B1&paper_id=&key_name=%ED%99%A9%EA%B0%95%EC%9A%B1&key_locale=in(Ganguk Hwang) 2014-08-28 2014 KAIST-FUDAN Workshop on Analysis and Applied Mathematics - Efficient algorithms for computing the non and semi-parametric maximum likelihood estimates with panel count data http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7393&ko_name=Lu%2C+Li+Qiang&paper_id= (Liqiang Lu) 2014-08-28 2014 KAIST-FUDAN Workshop on Analysis and Applied Mathematics - Asymptotics of the solution to the conductivity equation in the presence of adjacent circular inclusions with nite conductivities http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4320&ko_name=%EC%9E%84%EB%AF%B8%EA%B2%BD&paper_id=&key_name=%EC%9E%84%EB%AF%B8%EA%B2%BD&key_locale=in(Mikyoung Lim) 2014-08-28 2014 KAIST-FUDAN Workshop on Analysis and Applied Mathematics - Cell motility driven by motor proteins http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7389&ko_name=Zhang%2C+Yun+Xin&paper_id=(Yunxin Zhang) 2014-08-28 Discrete Math - Finding a spanning Halin subgraph in 3-connected {K_{1,3}, P_5}-free graphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5123&ko_name=O%2C+Suil&paper_id=(Suil O) 2014-08-28 2014 KAIST-FUDAN Workshop on Analysis and Applied Mathematics - A modi ed P_1 - immersed nite element method http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2203&ko_name=%EA%B3%BD%EB%8F%84%EC%98%81&paper_id=&key_name=%EA%B3%BD%EB%8F%84%EC%98%81&key_locale=in(Doyoung Kwak) 2014-08-27 2014 KAIST-FUDAN Workshop on Analysis and Applied Mathematics - Statistical Condition Estimates and Randomized Algorithms for Large-Scale Total Least Squares Problems http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4464&ko_name=Yimin+Wei&paper_id=(Yimin Wei) 2014-0827 2014 KAIST-FUDAN Workshop on Analysis and Applied Mathematics - Stability of Generalized Inversion Formulas for Toeplitz Matrices (Pengpeng Xie) 2014-08-27 2014 KAIST-FUDAN Workshop on Analysis and Applied Mathematics - Asymptotic behaviors of galactic dynamics http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4278&ko_name=%EA%B6%8C%EC%88%9C%EC%8B%9D&paper_id=&key_name=%EA%B6%8C%EC%88%9C%EC%8B%9D&key_locale=in(Soonsik Kwon) 2014-08-27 2014 KAIST-FUDAN Workshop on Analysis and Applied Mathematics - Stabilization of extrusion process modeled by hyperbolic systems coupled through a moving interface (Zhiqiang Wang) 2014-08-27 2014 KAIST-FUDAN Workshop on Analysis and Applied Mathematics - Starvation driven dispersal strategies of biological organisms http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4112&ko_name=%EA%B9%80%EC%9A%A9%EC%A0%95&paper_id=&key_name=%EA%B9%80%EC%9A%A9%EC%A0%95&key_locale=in(Yongjung Kim) 2014-08-27 2014 KAIST-FUDAN Workshop on Analysis and Applied Mathematics - Well-posedness and longtime behavior of a hydrodynamic system modeling vesicle and interactions http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4465&ko_name=Hao+Wu&paper_id=(Hao Wu) 2014-08-27 2014 KAIST-FUDAN Workshop on Analysis and Applied Mathematics - An elementary proof of Strauss conjecture (Yi Zhou) 2014-08-27 2014 KAIST-FUDAN Workshop on Analysis and Applied Mathematics - Recovery of missing samples in multi-channel oversampling http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2224&ko_name=%EA%B6%8C%EA%B8%B8%ED%97%8C&paper_id=&key_name=%EA%B6%8C%EA%B8%B8%ED%97%8C&key_locale=in(Kilhyun Kwon) 2014-08-27 2014 KAIST-FUDAN Workshop on Analysis and Applied Mathematics - A Meshless Symplectic Algorithm for multi-variant Hamiltonian PDEs with Radial Basis Approximation http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4674&ko_name=Wu+Zong+Min&paper_id=(Zongmin Wu) 2014-08-27 2014 KMRS - Random points and lattice points in convex bodies II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=6429&ko_name=B%C3%A1r%C3%A1ny%2C+Imre+&paper_id=(Imre Barany ) 2014-08-26 2014 KMRS - Random points and lattice points in convex bodies I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=6429&ko_name=B%C3%A1r%C3%A1ny%2C+Imre+&paper_id=(Imre Barany) 2014-08-25 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - Geometric T^k-equivariant complex bordism (Darby, Alastair) 2014-08-11 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - The theory of (2n,k)-manifolds (Terzić, Svetlana) 2014-08-11 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - Elliptic braid groups are duality groups http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=6423&ko_name=Denham%2C+Graham+C.&paper_id=(Denham, Graham) 2014-08-11 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - Torsions of cohomology of real toric manifolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5095&ko_name=%EB%B0%95%ED%95%9C%EC%B2%A0&paper_id=&key_name=%EB%B0%95%ED%95%9C%EC%B2%A0&key_locale=in(Park, Hanchul) 2014-08-11 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - Orbifold and non-orbifold linear symplectic quotients http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=6422&ko_name=Seaton%2C+Christopher&paper_id=(Seaton, Christopher) 201408-11 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - On a class of quotient spaces of moment-angle complexes (Yu, Li) 2014-08-11 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - On the classification of toric varieties http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4471&ko_name=%EC%B5%9C%EC%88%98%EC%98%81&paper_id=&key_name=%EC%B5%9C%EC%88%98%EC%98%81&key_locale=in(Choi, Suyoung) 2014-08-11 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - Complex subvarieties in homogeneous complex manifolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4498&ko_name=Misha+Verbitsky&paper_id=(Verbitsky, Misha) 2014-0810 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - On diffeomorphic moment-angle manifolds (Bosio, Frédéric) 2014-08-10 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - On the toric manifolds arising from the root systems of type B and type C http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=6416&ko_name=Abe%2C+Hiraku&paper_id=(Abe, Hiraku) 2014-08-10 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - The cohomology algebra of polyhedral product spaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=6426&ko_name=Zheng%2C+Qi+Bing&paper_id=(Zheng, Qibing) 2014-08-10 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - Torus fibrations and localization of index http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4412&ko_name=Takahiko+Yoshida&paper_id=(Yoshida, Takahiko) 2014-08-10 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - On well-definedness of the local index http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=6425&ko_name=Fujita%2C+Hajime&paper_id=(Fujita, Hajime) 2014-08-10 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - On contractibility of Koras-Russell threefolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=6424&ko_name=Krishna%2C+Amalendu&paper_id=(Krishna, Amalendu) 2014-08-10 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - Monomial equivariant embeddings of quasitoric manifolds and the problem of existence of invariant almost complex structures (Kustarev, Andrei) 2014-08-10 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - Homology of manifolds with locally standard torus actions http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=6421&ko_name=Ayzenberg%2C+Anton+And&paper_id=(Ayzenberg, Anton) 2014-08-10 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - Complexity one GKM graph with symmetries and an obstruction to be a torus graph http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=6420&ko_name=Kuroki%2C+Shintar%C3%B4&paper_id=(Kuroki, Shintaro) 2014-08-10 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - Hamiltonian loops on symplectic blow ups http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=6419&ko_name=Pedroza%2C+Andr%C3%A9s+&paper_id=(Pedroza, Andres) 2014-0810 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - Symplectic capacities from Hamiltonian circle actions (Hwang, Taekgyu) 2014-08-10 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - Newton-Okounkov bodies, symplectic geometry, and representation theory http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4642&ko_name=Megumi+Harada&paper_id=(Harada, Megumi) 2014-08-09 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - Integrable systems, toric degenerations and Newton-Okounkov bodies http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=6417&ko_name=Kaveh%2C+Kiumars+&paper_id=(Kaveh, Kiumars) 2014-08-09 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - Examples of toric manifolds whose orbit spaces by the compact torus are not simple polytopes (Suyama, Yusuke) 2014-08-09 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - Complex manifolds with maximal torus actions http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=6428&ko_name=Ishida%2C+Hiroaki&paper_id=(Ishida, Hiroaki) 2014-08-08 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - Demazure operators and geometric mitosis http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=6427&ko_name=Kiritchenko%2C+Valenti&paper_id=(Kiritchenko, Valentina) 2014-08-08 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - Explicit triangulation of complex projective spaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5094&ko_name=Soumen+Sarkar&paper_id=(Sarkar, Soumen) 2014-08-08 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - The integral cohomology ring of toric orbifolds and weighted projective towers (Song, Jongbaek) 2014-08-08 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - Toric varieties and finite domination of chain complexes (Huettemann, Thomas) 2014-08-08 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - The cohomology ring structure of the symmetric square of HP^n (Boote, Yumi) 2014-08-08 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - Vector partition functions and the topology of multiple weight varieties http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=6418&ko_name=Takakura%2C+Tatsuru&paper_id=(Takakura, Tatsuru) 2014-08-08 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - Simple polytopes and simplicial complexes with Buchstaber number 2 (Erokhovets, Nikolay) 2014-08-08 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - McKay correspondence in quasitoric orbifolds (Ganguli, Saiball) 2014-08-08 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - Combinatorics of simple polytopes, their Stanley-Reisner rings and moment-angle manifolds (Limonchenko, Ivan) 2014-08-08 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - Okounkov bodies, toric degenerations, and Bott-Samelson varieties (Yang, Jihyeon Jessie) 2014-08-08 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - The convex hull of a space curve http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Sturmfels, Bernd) 2014-08-08 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - Combinatorial covers, abelian duality, and propagation of resonance http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7390&ko_name=Suciu%2C+Alexander+I.&paper_id=(Suciu, Alexandru ) 2014-08-07 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - Recent results about polyhedral products and toric spaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5124&ko_name=Tony+Bahri&paper_id=(Bahri, Anthony) 2014-08-07 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - On equivariant Pieri rule of isotropic Grassmannians http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7391&ko_name=Li%2C+Changzheng+&paper_id=(Li, Changzheng) 2014-08-07 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - Schubert polynomials and pipe dreams http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=7392&ko_name=Smirnov%2C+Evgeny&paper_id=(Smirnov, Evgeny) 2014-08-07 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - A family of polytopal moment-angle manifolds (Cai, Li) 2014-08-07 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - Spin toric manifolds associated to graphs (Hatanaka, Miho) 2014-08-07 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - Betti numbers of toric origami manifolds (Park, Seonjeong) 2014-08-07 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - The equivariant cohomology rings of Peterson varieties in all Lie types (Horiguchi, Tatsuya) 2014-08-07 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - Equivariant Giambelli formula for isotropic flag varieties http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5090&ko_name=Tomoo+Matsumura&paper_id=(Matsumura, Tomoo) 201408-07 (ICM 2014 Satellite conference) Topology of torus actions and applications to geometry and combinatorics - Complex geometry of moment-angle manifolds (Eliyashev, Yury) 2014-08-07 Discrete Math - Fun with wires ( ) 2014-08-01 Discrete Math - Graph Structures and Well-Quasi-Ordering (Chun-Hung Liu) 2014-07-29 2014 Topology Seminar - Okounkov bodies, toric degenerations, and bott-samelson varieties (Jihyeon Jessie Yang ) 2014-07-24 2014 Topology Seminar - Okounkov bodies, toric degenerations, and bott-samelson varieties III (Jihyeon Jessie Yang ) 2014-07-22 2014 Topology Seminar - Okounkov bodies, toric degenerations, and bott-samelson varieties II (Jihyeon Jessie Yang) 2014-07-17 2014 Topology Seminar - Okounkov bodies, toric degenerations, and bott-samelson varieties I (Jihyeon Jessie Yang) 2014-07-15 Discrete Math - Choosability of Toroidal Graphs with Forbidden Structures ( ) 2014-07-07 The 2nd Number theory workshop - Automorphisms and geometry of K3 surfaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2259&ko_name=%EA%B8%88%EC%A2%85%ED%95%B4&paper_id=&key_name=%EA%B8%88%EC%A2%85%ED%95%B4&key_locale=in( ) 2014-07-05 The 2nd Number theory workshop - Mock modular period functions and L-functions of cusp forms in higher level cases http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4005&ko_name=%EC%B5%9C%EC%86%8C%EC%98%81&paper_id=&key_name=%EC%B5%9C%EC%86%8C%EC%98%81&key_locale=in( ) 2014-07-05 KMRS Intensive Lectures by Bernd Sturmfels - Introduction to Non-Linear Algebra : Nash Equilibria I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Bernd Sturmfels) 2014-07-04 KMRS Intensive Lectures by Bernd Sturmfels - Introduction to Non-Linear Algebra : Nash Equilibria II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Bernd Sturmfels) 2014-07-04 KMRS Intensive Lectures by Bernd Sturmfels - Introduction to Non-Linear Algebra : Representation Theory I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Bernd Sturmfels) 2014-07-03 KMRS Intensive Lectures by Bernd Sturmfels - Introduction to Non-Linear Algebra : Representation Theory II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Bernd Sturmfels) 2014-07-03 Discrete Math - The generalized cycle-cocycle reversal system for partial graph orientations (Spencer Backman) 2014-06-30 KMRS Intensive Lectures by Bernd Sturmfels - Introduction to Non-Linear Algebra : Tensors I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Bernd Sturmfels) 2014-06-27 KMRS Intensive Lectures by Bernd Sturmfels - Introduction to Non-Linear Algebra : Tensors II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Bernd Sturmfels) 2014-06-27 KMRS Intensive Lectures by Bernd Sturmfels - Introduction to Non-Linear Algebra : Tensors III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Bernd Sturmfels) 2014-06-27 2014 KMRS - Geometry, algebra and computation in moduli theory http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4314&ko_name=%ED%98%84%EB%8F%99%ED%9B%88&paper_id=&key_name=%ED%98%84&key_locale=in(David Hyeon) 2014-06-27 2014 KMRS - An algorithm for path-width and branch-width of matroids http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4229&ko_name=%EC%97%84%EC%83%81%EC%9D%BC&paper_id=&key_name=%EC%97%84%EC%83%81%EC%9D%BC&key_locale=in( ) 2014-06-27 KMRS Intensive Lectures by Bernd Sturmfels - Introduction to Non-Linear Algebra : Invariant Theory I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Bernd Sturmfels) 2014-06-26 KMRS Intensive Lectures by Bernd Sturmfels - Introduction to Non-Linear Algebra : Invariant Theory II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Bernd Sturmfels) 2014-06-26 KMRS Intensive Lectures by Bernd Sturmfels - Introduction to Non-Linear Algebra : Invariant Theory III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Bernd Sturmfels) 2014-06-26 Discrete Math - ABC Theorems and Buchi's Problem over Function Fields http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5164&ko_name=+Wang%2C+Julie+Tzu-Yue&paper_id=(Julie Tzu-Yueh Wang) 2014-06-25 Discrete Math - Exclusivity graphs from quantum graph states – and mixed graph generalisations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5165&ko_name=Parker%2C+Matthew+Geof&paper_id=(Matthew G. Parker) 2014-06-24 Discrete Math - Polytopes defined by oracles: algorithms and combinatorics (Vissarion Fisikopoulos) 2014-06-23 KMRS Intensive Lectures by Bernd Sturmfels - Introduction to Non-Linear Algebra : Nonnegative Polynomials and Sums of Squares I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Bernd Sturmfels) 2014-06-13 KMRS Intensive Lectures by Bernd Sturmfels - Introduction to Non-Linear Algebra : Nonnegative Polynomials and Sums of Squares II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Bernd Sturmfels) 2014-06-13 2014 ASARC - Higher convexity of coamoeba complements http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5161&ko_name=Sottile%2C+Frank&paper_id=(Frank Sottile) 2014-06-13 2014 ASARC - Gluing property of matroid base polytopes (Jaeho Shin) 2014-06-13 2014 ASARC - Ranks and cactus ranks of particular sums of polynomials ( ) 2014-06-13 2014 ASARC - Equations of Abo-Wan hypersurfaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5160&ko_name=Oeding%2C+Luke&paper_id=(Luke Oeding) 2014-06-13 KMRS Intensive Lectures by Bernd Sturmfels - Introduction to Non-Linear Algebra : Semidefinite Programming I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Bernd Sturmfels) 2014-06-12 KMRS Intensive Lectures by Bernd Sturmfels - Introduction to Non-Linear Algebra : Semidefinite Programming II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Bernd Sturmfels) 2014-06-12 KMRS Intensive Lectures by Bernd Sturmfels - Introduction to Non-Linear Algebra : Semidefinite Programming III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Bernd Sturmfels) 2014-06-12 Discrete Math - On r-dynamic coloring of graphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=8158&ko_name=%EA%B9%80%EC%9E%AC%ED%9B%88&paper_id=( ) 2014-06-09 KMRS Intensive Lectures by Bernd Sturmfels - Introduction to Non-Linear Algebra : Tropical Algebra I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Bernd Sturmfels) 2014-06-05 KMRS Intensive Lectures by Bernd Sturmfels - Introduction to Non-Linear Algebra : Tropical Algebra II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Bernd Sturmfels) 2014-06-05 Discrete Math - Quasi-Polynomial Time Approximation Scheme for Sparse Subsets of Polygons http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5159&ko_name=Har-Peled%2C+Sariel+&paper_id=(Sariel Har-Peled) 2014-06-02 KMRS Intensive Lectures by Bernd Sturmfels - Introduction to Non-Linear Algebra : Polyhedral Homotopies I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Bernd Sturmfels) 2014-05-30 KMRS Intensive Lectures by Bernd Sturmfels - Introduction to Non-Linear Algebra : Polyhedral Homotopies II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Bernd Sturmfels) 2014-05-30 - ( ) 2014-05-30 KMRS Intensive Lectures by Bernd Sturmfels - Introduction to Non-Linear Algebra : Sparse Polynomial Systems I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Bernd Sturmfels) 2014-05-29 KMRS Intensive Lectures by Bernd Sturmfels - Introduction to Non-Linear Algebra : Sparse Polynomial Systems II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Bernd Sturmfels) 2014-05-29 Discrete Math - A polynomial-time algorithm for outerplanar diameter improvement (Eunjung Kim) 2014-05-26 KMRS Intensive Lectures by Bernd Sturmfels - Introduction to Non-Linear Algebra : Decomposing Varieties I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Bernd Sturmfels) 2014-05-23 KMRS Intensive Lectures by Bernd Sturmfels - Introduction to Non-Linear Algebra : Decomposing Varieties II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Bernd Sturmfels) 2014-05-23 KMRS Intensive Lectures by Bernd Sturmfels - Introduction to Non-Linear Algebra : Elimination I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Bernd Sturmfels) 2014-05-22 KMRS Intensive Lectures by Bernd Sturmfels - Introduction to Non-Linear Algebra : Elimination II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Bernd Sturmfels) 2014-05-22 2014 KAIST Math. Colloquium - The calculus of variations and phase transition problems http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4417&ko_name=Paul+H.+Rabinowitz&paper_id=(Paul Rabinowitz) 2014-05-22 Discrete Math - Nearly planar graphs and graph minor obstructions for embedding on the spindle surface ( ) 2014-05-19 KAIST CMC Intensive Lecture - Stable capillary hypersurfaces in a wedge http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1918&ko_name=%EC%B5%9C%EC%9E%AC%EA%B2%BD&paper_id=&key_name=%EC%B5%9C%EC%9E%AC%EA%B2%BD&key_locale=in( ) 2014-05-16 - 3D ( ) 2014-05-16 2014 KAIST Math. Colloquium - Metamaterials: high contrast composites with unusual properties http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5163&ko_name=Milton%2C+Graeme+Walte&paper_id=(Graeme Milton) 2014-05-15 Discrete Math - Cops, robbers, infinite graphs and related problems http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5172&ko_name=Hahn%2C+Ge%C5%88a&paper_id=(Gena Hahn) 2014-05-14 Discrete Math - Parameterized Approximation Schemes using Graph Widths http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5171&ko_name=Lampis%2C+Michael&paper_id=(Michael Lampis) 2014-05-13 Discrete Math - The computational complexity of the game of SET and its theoretical applications http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5170&ko_name=+Mitsou%2C+Valia&paper_id=(Valia Mitsou) 2014-05-12 - Processes and products in tidal-fluvial transition : keys to successful reservoir characterization ( ) 2014-05-09 Discrete Math - Combinatorial Laplacians and high dimensional tree numbers http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4402&ko_name=%EA%B5%AD%EC%9B%85&paper_id=&key_name=%EA%B5%AD%EC%9B%85&key_locale=in( ) 2014-05-08 KAIST CMC Intensive Lecture - Compactness, Dirichlet's principle and Sobolev space http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=761&ko_name=%EC%84%9C%EC%A7%84%EA%B7%BC&paper_id=&key_name=%EC%84%9C%EC%A7%84%EA%B7%BC&key_locale=in( ) 2014-05-02 - LA-ICP-MS ( ) 2014-05-02 ASARC by Yoshinori Namikawa - A characterization of nilpotent varieties of complex semisimple Lie algebras IV http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4724&ko_name=Yoshinori+NAMIKAWA&paper_id=(Yoshinori Namikawa) 2014-05-01 2014 KAIST Math. Colloquium - Introduction to Commutative Algebra of Singularities (Kei-ichi Watanabe) 2014-05-01 ASARC by Yoshinori Namikawa - A characterization of nilpotent varieties of complex semisimple Lie algebras III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4724&ko_name=Yoshinori+NAMIKAWA&paper_id=(Yoshinori Namikawa) 2014-04-30 ASARC by Yoshinori Namikawa - A characterization of nilpotent varieties of complex semisimple Lie algebras I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4724&ko_name=Yoshinori+NAMIKAWA&paper_id=(Yoshinori Namikawa) 2014-04-29 ASARC by Yoshinori Namikawa - A characterization of nilpotent varieties of complex semisimple Lie algebras II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4724&ko_name=Yoshinori+NAMIKAWA&paper_id=(Yoshinori Namikawa) 2014-04-29 Discrete Math - F-Matchings in a tree http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5169&ko_name=Law%2C+Hiu+Fai&paper_id=(Hiu-Fai Law) 2014-04-28 2014 - Open KIAS - Categorification of Donaldson-Thomas invariants by perverse sheaves http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4231&ko_name=%EA%B9%80%EC%98%81%ED%9B%88&paper_id=&key_name=%EA%B9%80%EC%98%81%ED%9B%88&key_locale=in(Kiem YoungHoon) 2014-04-25 - Alaska Megathrust : Imaging the megathrust zone and Yakutat/Pacific plate interface in the Alaska subduction zone ( ) 2014-04-25 2014 - Opne KIAS - http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=761&ko_name=%EC%84%9C%EC%A7%84%EA%B7%BC&paper_id=&key_name=%EC%84%9C%EC%A7%84%EA%B7%BC&key_locale=in(SeoJinKeun) 2014-04-24 KAIST CMC Intensive Lecture - Volume conjecture and optimistic limit http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=341&ko_name=%EA%B9%80%ED%98%81&paper_id=&key_name=%EA%B9%80%ED%98%81&key_locale=in( ) 2014-04-18 2014 KAIST Math. Colloquium - Computational aspects in Multi-dimensional symbolic dynamics ( ) 2014-04-17 Discrete Math - Graph Polynomials from simple graph sequences http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5168&ko_name=Goodall%2C+Andrew&paper_id=(Andrew Goodall) 2014-04-14 - Investigation of slope failures based on physical model study ( ) 2014-04-11 2014 KAIST Math. Colloquium - Propensity-score-adjustment method for nonignorable nonresponse ( ) 2014-04-10 Discrete Math - Pfaffian Sum formula of the double Schubert polynomials for the symplectic Grassmannians http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5090&ko_name=Tomoo+Matsumura&paper_id=(Tomoo Matsumura) 2014-04-08 - ( ) 2014-04-04 Discrete Math - A conditional lower bound for computing the Gromov hyperbolicity of a discrete metric space http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5167&ko_name=Vigneron%2C+Antoine&paper_id=(Antoine Vigneron) 2014-03-31 KAIST CMC Intensive Lecture - Non-abelian reciprocity laws http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4572&ko_name=%EA%B9%80%EB%AF%BC%ED%98%95&paper_id=&key_name=%EA%B9%80%EB%AF%BC%ED%98%95&key_locale=in( ) 2014-03-28 - Minerals in Korean air : source, transport, and deposition ( ) 2014-03-28 2014 KAIST Math. Colloquium - A construction of surfaces with big higher Chow group http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4510&ko_name=Tomohide+Terasoma&paper_id=(Tomohide Terasoma) 2014-03-27 Discrete Math - Determining the Winner of a Dodgson Election is Hard http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5166&ko_name=Rosamond%2C+Frances+A.&paper_id=(Frances A. Rosamond) 2014-03-25 KAIST CMC School on Algebraic Geometry - Syzygies and geometry of curves 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4414&ko_name=Marian+Aprodu&paper_id=(Aprodu, Marian) 2014-03-21 KAIST CMC School on Algebraic Geometry - Syzygies and geometry of curves 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4414&ko_name=Marian+Aprodu&paper_id=(Aprodu, Marian) 2014-03-21 KAIST CMC School on Algebraic Geometry - Topological methods in moduli theory 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4537&ko_name=Fabrizio+Catanese&paper_id=(Catanese, Fabrizio) 2014-03-21 KAIST CMC School on Algebraic Geometry - Topological methods in moduli theory 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4537&ko_name=Fabrizio+Catanese&paper_id=(Catanese, Fabrizio) 2014-03-21 - - : , , ( ) 2014-03-21 KAIST CMC School on Algebraic Geometry - Smoothings of complex normal surface singularities 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5173&ko_name=Wahl%2C+Jonathan+M.+&paper_id=(Wahl, Jonathan) 2014-03-20 KAIST CMC School on Algebraic Geometry - Smoothings of complex normal surface singularities 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5173&ko_name=Wahl%2C+Jonathan+M.+&paper_id=(Wahl, Jonathan) 2014-03-20 KAIST CMC School on Algebraic Geometry - Construction and compactification of moduli spaces 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4290&ko_name=Radu+Laza&paper_id=(Laza, Radu) 2014-03-20 KAIST CMC School on Algebraic Geometry - Construction and compactification of moduli spaces 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4290&ko_name=Radu+Laza&paper_id=(Laza, Radu) 2014-03-20 2014 KAIST Special Lecture Series - Beyond the McKay correspondence http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2014-03-20 KAIST CMC School on Algebraic Geometry - Syzygies and geometry of curves 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4414&ko_name=Marian+Aprodu&paper_id=(Aprodu, Marian) 2014-03-19 KAIST CMC School on Algebraic Geometry - Syzygies and geometry of curves 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4414&ko_name=Marian+Aprodu&paper_id=(Aprodu, Marian) 2014-03-19 KAIST CMC School on Algebraic Geometry - Topological methods in moduli theory 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4537&ko_name=Fabrizio+Catanese&paper_id=(Catanese, Fabrizio) 2014-03-19 KAIST CMC School on Algebraic Geometry - Topological methods in moduli theory 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4537&ko_name=Fabrizio+Catanese&paper_id=(Catanese, Fabrizio) 2014-03-19 KAIST CMC School on Algebraic Geometry - Smoothings of complex normal surface singularities 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5173&ko_name=Wahl%2C+Jonathan+M.+&paper_id=(Wahl, Jonathan) 2014-03-18 KAIST CMC School on Algebraic Geometry - Smoothings of complex normal surface singularities 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5173&ko_name=Wahl%2C+Jonathan+M.+&paper_id=(Wahl, Jonathan) 2014-03-18 KAIST CMC School on Algebraic Geometry - Construction and compactification of moduli spaces 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4290&ko_name=Radu+Laza&paper_id=(Laza, Radu) 2014-03-18 KAIST CMC School on Algebraic Geometry - Construction and compactification of moduli spaces 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4290&ko_name=Radu+Laza&paper_id=(Laza, Radu) 2014-03-18 KAIST CMC Intensive Lecture - Introduction to syzygies 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4414&ko_name=Marian+Aprodu&paper_id=(Marian Aprodu) 2014-03-14 2014 KAIST Math. Colloquium - From constant mean curvature surfaces to overdetermined elliptic problems http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4950&ko_name=Filippo+Morabito&paper_id=(Filippo Morabito) 2014-03-13 KAIST CMC Intensive Lecture - Introduction to syzygies 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4414&ko_name=Marian+Aprodu&paper_id=(Marian Aprodu) 2014-03-13 KAIST CMC Intensive Lecture - Introduction to syzygies 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4414&ko_name=Marian+Aprodu&paper_id=(Marian Aprodu) 2014-03-11 KAIST CMC Intensive Lecture - Introduction to syzygies 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4414&ko_name=Marian+Aprodu&paper_id=(Marian Aprodu) 2014-03-07 The 3rd Number Theory Festival - Continued fraction and distribution of modular symbols http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5070&ko_name=%EC%84%A0%ED%95%B4%EC%83%81&paper_id=&key_name=%EC%84%A0%ED%95%B4%EC%83%81&key_locale=in(Sun Haesang) 2014-02-22 The 3rd Number Theory Festival - Lindelof hypothesis on average for triple product L-functions and its application (Jung Junehyuk) 2014-02-22 The 3rd Number Theory Festival - Overview of Bloch-Kato conjecture http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4624&ko_name=%EB%AA%85%EC%84%B1&paper_id=&key_name=%EB%AA%85%EC%84%B1&key_locale=in(Myung Sung) 2014-02-22 12th Korea-Japan Workshop on Algebra and Combinatorics (KJ2014) - Characterization of the bilinear forms graphs Bil2(n; n), n > 2, by their intersection arrays. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5147&ko_name=Gavrilyuk%2C+Alexander&paper_id=(Alexander Gavrilyuk) 2014-01-25 12th Korea-Japan Workshop on Algebra and Combinatorics (KJ2014) - Nonexistence results for complex equiangular tight frames. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5146&ko_name=Sz%C3%B6ll%C5%91si%2C+Ferenc&paper_id=(Ferenc Szollosi) 2014-01-25 12th Korea-Japan Workshop on Algebra and Combinatorics (KJ2014) - Travel groupoids on graphs. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4422&ko_name=Yoshio+Sano&paper_id=(Yoshio Sano) 2014-01-25 12th Korea-Japan Workshop on Algebra and Combinatorics (KJ2014) - The Selberg integral and Young books. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5151&ko_name=%EA%B9%80%EC%9E%A5%EC%88%98&paper_id=&key_name=%EA%B9%80%EC%9E%A5%EC%88%98&key_locale=in(JangSoo Kim) 2014-01-24 12th Korea-Japan Workshop on Algebra and Combinatorics (KJ2014) - Signed tree associahedra. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5150&ko_name=Pilaud%2C+Vincent&paper_id=(Vincent Pilaud) 2014-01-24 12th Korea-Japan Workshop on Algebra and Combinatorics (KJ2014) - Enumeration of toric objects and wedge operation on simplicial complexes. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4471&ko_name=%EC%B5%9C%EC%88%98%EC%98%81&paper_id=&key_name=%EC%B5%9C%EC%88%98%EC%98%81&key_locale=in(Suyoung Choi) 2014-01-24 12th Korea-Japan Workshop on Algebra and Combinatorics (KJ2014) - Chromatic-choosability of the power of graphs. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5149&ko_name=%EB%B0%95%EB%B3%B4%EB%9E%8C&paper_id=&key_name=%EB%B0%95%EB%B3%B4%EB%9E%8C&key_locale=in(Boram Park) 2014-01-24 12th Korea-Japan Workshop on Algebra and Combinatorics (KJ2014) - Epsilon net and Helly type theorems for unit balls and k-flat transversals. (Michael Dobbins) 2014-01-24 12th Korea-Japan Workshop on Algebra and Combinatorics (KJ2014) - a-, q-, lambda generalization of poly-Bernoulli numbers and poly- Cauchy numbers. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5156&ko_name=Komatsu%2C+Takao&paper_id=(Takao Komatsu) 2014-01-23 12th Korea-Japan Workshop on Algebra and Combinatorics (KJ2014) - Tight relative t-designs on Q-polynomial association schemes. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5155&ko_name=Bannai%2C+Etsuko&paper_id=(Etsuko Bannai) 2014-01-23 12th Korea-Japan Workshop on Algebra and Combinatorics (KJ2014) - Bounds on eigenvalues for distance-regular graphs. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5154&ko_name=%EB%B0%95%EC%A2%85%EC%9A%B1&paper_id=&key_name=%EB%B0%95%EC%A2%85%EC%9A%B1&key_locale=in(Jongyook Park) 2014-01-23 12th Korea-Japan Workshop on Algebra and Combinatorics (KJ2014) - Arrangements of double pseudolines. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5153&ko_name=Pocchiola%2CMichel&paper_id=(Michel Pocchiola) 2014-01-23 12th Korea-Japan Workshop on Algebra and Combinatorics (KJ2014) - Geometric flows for quadrature surfaces. (Michiaki Onodera) 2014-01-23 12th Korea-Japan Workshop on Algebra and Combinatorics (KJ2014) - Unavoidable vertex-minors in large prime graphs. (O-joung Kwon) 2014-01-23 12th Korea-Japan Workshop on Algebra and Combinatorics (KJ2014) - The classi cation of TD-pairs of Type II. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5152&ko_name=Ito%2C+Tatsuro&paper_id=(Tatsuro Ito) 2014-01-23 Back to top of page 2013 - ( ) 2013-12-06 2013 KAIST Math. Colloquium - Generalizing Witt vector construction http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3818&ko_name=%EC%98%A4%EC%98%81%ED%83%81&paper_id=&key_name=%EC%98%A4%EC%98%81%ED%83%81&key_locale=in(
) 2013-12-
05 KAIST Special Lecture Series - Linear syzygies of Veronese varieties (Thanh Vu) 2013-12-04 KAIST Special Lecture Series - Finiteness of log pluricanonical representation, I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5144&ko_name=Gongyo%2C+Yoshinori&paper_id=(Yoshinori Gongyo) 2013-12-03 KAIST Special Lecture Series - Finiteness of log pluricanonical representation, II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5144&ko_name=Gongyo%2C+Yoshinori&paper_id=(Yoshinori Gongyo) 2013-12-03 KAIST Special Lecture Series - One approach to the abundance conjecture, I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5144&ko_name=Gongyo%2C+Yoshinori&paper_id=(Yoshinori Gongyo) 2013-11-29 KAIST Special Lecture Series - One approach to the abundance conjecture, II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5144&ko_name=Gongyo%2C+Yoshinori&paper_id=(Yoshinori Gongyo) 2013-11-29 - LA-ICP-MS ( ) 2013-11-29 KMRS Chair Professor Inaugural Lecture Series - Global dynamics of nonlinear wave equations_4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5143&ko_name=Nakanishi%2C+Kenji&paper_id=(Kenji Nakanishi) 2013-11-22 - , ( ) 2013-11-22 2013 KAIST Math. Colloquium - Threshold manifolds for global dynamics of nonlinear dispersive equations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5143&ko_name=Nakanishi%2C+Kenji&paper_id=(Kenji Nakanishi) 2013-11-21 KMRS Chair Professor Inaugural Lecture Series - Global dynamics of nonlinear wave equations_3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5143&ko_name=Nakanishi%2C+Kenji&paper_id=(Kenji Nakanishi) 2013-11-20 KMRS Chair Professor Inaugural Lecture Series - Global dynamics of nonlinear wave equations_2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5143&ko_name=Nakanishi%2C+Kenji&paper_id=(Kenji Nakanishi) 2013-11-19 KMRS Chair Professor Inaugural Lecture Series - Global dynamics of nonlinear wave equations_1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5143&ko_name=Nakanishi%2C+Kenji&paper_id=(Kenji Nakanishi) 2013-11-18 KMRS Chair Professor Inaugural Lecture Series - Lectures on linear and quasilinear systems involving curl.(Part 4. A quasilinear system for Meissner states of superconductors.) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4894&ko_name=Xingbin+Pan&paper_id=(Xingbin Pan) 2013-1113 KMRS Chair Professor Inaugural Lecture Series - Lectures on linear and quasilinear systems involving curl.(Part 5. Extended Born-Infeld model.) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4894&ko_name=Xingbin+Pan&paper_id=(Xingbin Pan) 2013-11-13 KAIST Special Lecture Series - Projective invariants of algebraic varieties Lecture 5 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4427&ko_name=Fyodor+L.+Zak&paper_id=(Fyodor Zak) 2013-11-13 KAIST Special Lecture Series - Generic semi-positivity and applications to families of canonically polarized manifolds, II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4787&ko_name=Mihai+Paun&paper_id=(Mihai Paun) 2013-11-13 KAIST Special Lecture Series - Generic semi-positivity and applications to families of canonically polarized manifolds, I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4787&ko_name=Mihai+Paun&paper_id=(Mihai Paun) 2013-11-12 KMRS Chair Professor Inaugural Lecture Series - Lectures on linear and quasilinear systems involving curl.(Part 3. Linear systems involving curl.) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4894&ko_name=Xingbin+Pan&paper_id=(Xingbin Pan) 2013-11-11 KMRS Chair Professor Inaugural Lecture Series - Lectures on linear and quasilinear systems involving curl.(Part 1. Partial differential systems involving curl.) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4894&ko_name=Xingbin+Pan&paper_id=(Xingbin Pan) 2013-11-08 KMRS Chair Professor Inaugural Lecture Series - Lectures on linear and quasilinear systems involving curl. (Part 2. Spaces of vector fields defined by curl and divergence.) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4894&ko_name=Xingbin+Pan&paper_id=(Xingbin Pan) 2013-11-08 - 9B ( ) 2013-11-08 KAIST Special Lecture Series - Projective invariants of algebraic varieties Lecture 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4427&ko_name=Fyodor+L.+Zak&paper_id=(Fyodor Zak) 2013-11-07 2013 KAIST Math. Colloquium - ICM 20 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3745&ko_name=%EB%B0%95%ED%98%95%EC%A3%BC&paper_id=&key_name=%EB%B0%95%ED%98%95%EC%A3%BC&key_locale=in(Hyungju Park) 2013-11-07 KAIST Special Lecture Series - Projective invariants of algebraic varieties Lecture 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4427&ko_name=Fyodor+L.+Zak&paper_id=(Fyodor Zak) 2013-11-06 2013 KMRS Symposium on Algebraic Geometry - Non-rationality of the hypersurfaces in the 95 families of Fletcher and Reid. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3735&ko_name=%EB%B0%95%EC%A7%80%ED%9B%88&paper_id=&key_name=%EB%B0%95%EC%A7%80%ED%9B%88&key_locale=in(Jihun Park) 2013-11-02 2013 KMRS Symposium on Algebraic Geometry - Dual varieties, orthogonality theorem, and osculating spaces II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4427&ko_name=Fyodor+L.+Zak&paper_id=(Fyodor Zak) 2013-11-02 KAIST Special Lecture Series - Ordering Knot Groups Lecture 3: Fibred knots and the Alexander polynomial. (Dale Rolfsen) 2013-11-01 - Mathematics and Industry http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2588&ko_name=Fadil+Santosa&paper_id=Fadil(FadiSantosa) 2013-11-01 - A Mathematical Challenge at AIMR- Direct Collaboration with Materials Science http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5140&ko_name=Kotani%2C+Motoko&paper_id=(Motoko Kotani) 2013-11-01 - An Overview on the Activities at Korea Institute for Advanced Study http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2259&ko_name=%EA%B8%88%EC%A2%85%ED%95%B4&paper_id=&key_name=%EA%B8%88%EC%A2%85%ED%95%B4&key_locale=in(JongHae Keum) 2013-11-01 - Realizations of Mathematical Inspiration http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2340&ko_name=%EC%98%A4%EC%9A%A9%EA%B7%BC&paper_id=&key_name=%EC%98%A4%EC%9A%A9%EA%B7%BC&key_locale=in(Yong-Geun Oh) 2013-11-01 - CAMP as a Research Communications Hub http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3745&ko_name=%EB%B0%95%ED%98%95%EC%A3%BC&paper_id=&key_name=%EB%B0%95%ED%98%95%EC%A3%BC&key_locale=in(HyungJu Park) 2013-11-01 2013 KMRS Symposium on Algebraic Geometry - Tangential nondegeneracy of projective varieties I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2086&ko_name=%ED%99%A9%EC%A4%80%EB%AC%B5&paper_id=&key_name=%ED%99%A9%EC%A4%80%EB%AC%B5&key_locale=in(Jun-Muk Hwang) 2013-11-01 2013 KMRS Symposium on Algebraic Geometry - Dual varieties, orthogonality theorem, and osculating spaces I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4427&ko_name=Fyodor+L.+Zak&paper_id=(Fyodor Zak) 2013-11-01 2013 KMRS Symposium on Algebraic Geometry - Tangential nondegeneracy of projective varieties II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2086&ko_name=%ED%99%A9%EC%A4%80%EB%AC%B5&paper_id=&key_name=%ED%99%A9%EC%A4%80%EB%AC%B5&key_locale=in(Jun-Muk Hwang) 2013-11-01 2013 KMRS Symposium on Algebraic Geometry - On syzygies of K3 surfaces (Youngho Woo) 2013-11-01 2013 KMRS Symposium on Algebraic Geometry - The relative Hilbert of a projection morphism (Hosung Kim) 2013-11-01 - ( ) 2013-11-01 KMRS Chair Professor Inaugural Lecture Series - Matrix and Stochastic Independence in Graphical Models- Definitions, properties and results for regression graphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3383&ko_name=Nanny+Wermuth&paper_id=NannyW(Nanny Wermuth) 2013-10-31 KMRS Chair Professor Inaugural Lecture Series - Matrix representations and independencies in graphs - Constructing graphs from data and tracing pathways of development http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3383&ko_name=Nanny+Wermuth&paper_id=NannyW(Nanny Wermuth) 2013-10-31 2013 KAIST Math. Colloquium - Small cancellation theory in group theory http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3798&ko_name=%EC%9D%B4%EB%8F%99%ED%9D%AC&paper_id=&key_name=%EC%9D%B4%EB%8F%99%ED%9D%AC&key_locale=in(Donghi Lee) 2013-10-31 KAIST Special Lecture Series - Ordering Knot Groups Lecture 2: Knot groups. (Dale Rolfsen) 2013-10-30 KMRS Chair Professor Inaugural Lecture Series - Matrix and Stochastic Independence in Graphical Models - Illustrating different types of structures expressible as regression graphs by using symmetric binary variables http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3383&ko_name=Nanny+Wermuth&paper_id=NannyW(Nanny Wermuth) 2013-10-29 KMRS Chair Professor Inaugural Lecture Series - Matrix representations and independencies in graphs - More complex motivating examples from observational and intervention studies http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3383&ko_name=Nanny+Wermuth&paper_id=NannyW(Nanny Wermuth) 2013-10-29 KAIST Special Lecture Series - Projective invariants of algebraic varieties Lecture 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4427&ko_name=Fyodor+L.+Zak&paper_id=(Fyodor Zak) 2013-10-28 KAIST Special Lecture Series - Ordering Knot Groups Lecture 1: Introduction to orderable groups. (Dale Rolfsen) 2013-10-28 2013 - (Im)possibility of Cryptographic Properties in Bilinear Product Groups http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5142&ko_name=%EC%84%9C%EC%9E%AC%ED%99%8D&paper_id=&key_name=%EC%84%9C%EC%9E%AC%ED%99%8D&key_locale=in(Seo, Jae Hong) 2013-10-26 2013 NIMS-KMRS PDE Conference on reaction diffusion equations for ecology and related problems - Introduction to Adaptive Dynamics for Ecology http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5128&ko_name=%EC%A0%95%EC%9E%AC%EC%99%84&paper_id=&key_name=%EC%A0%95%EC%9E%AC%EC%99%84&key_locale=in(Chung, Jaywan) 2013-10-25 2013 NIMS-KMRS PDE Conference on reaction diffusion equations for ecology and related problems - Kinetic and Material Property Effects on fingering Instability in Counterflow Smoldering Combustion (Ijioma Ekeoma) 2013-10-25 2013 NIMS-KMRS PDE Conference on reaction diffusion equations for ecology and related problems - Coexistence steady-states to the Lotka-Volterra competition model with diffusion and advection http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5137&ko_name=Kuto%2C+Kousuke&paper_id=(Kuto, Kousuke) 2013-10-25 2013 - Geometry for separable states http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2171&ko_name=%EA%B3%84%EC%8A%B9%ED%98%81&paper_id=&key_name=%EA%B3%84%EC%8A%B9&key_locale=in(Kye, Seung-Hyeok) 2013-10-25 2013 - A group configuration theorem in model theory http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3826&ko_name=%EA%B9%80%EB%B3%91%ED%95%9C&paper_id=&key_name=%EA%B9%80%EB%B3%91%ED%95%9C&key_locale=in(Kim, Byunghan) 2013-10-25 2013 - A curve complex for a right-angled Artin group http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4058&ko_name=%EA%B9%80%EC%83%81%ED%98%84&paper_id=&key_name=%EA%B9%80%EC%83%81%ED%98%84&key_locale=in(Kim, Sang-hyun) 2013-10-25 2013 - Classification and decomposition of the Witt-Burnside ring and Burnside ring of a profinite group http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3818&ko_name=%EC%98%A4%EC%98%81%ED%83%81&paper_id=&key_name=%EC%98%A4%EC%98%81%ED%83%81&key_locale=in(Oh, Young-Tak) 2013-10-25 2013 NIMS-KMRS PDE Conference on reaction diffusion equations for ecology and related problems - Asymptotical behaviors of a general diffusive consumer-resource model with maturation delay http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3637&ko_name=%EA%B3%A0%EC%9B%90%EB%A5%A0&paper_id=&key_name=%EA%B3%A0%EC%9B%90%EB%A5%A0&key_locale=in(Ko, Wonlyul) 2013-10-24 2013 NIMS-KMRS PDE Conference on reaction diffusion equations for ecology and related problems - Alternans and Spiral Breakup in a Modified FitzHugh-Nagumo Model of Cardiac Cell Dynamics (Gani, Mohammad Osman) 2013-10-24 2013 NIMS-KMRS PDE Conference on reaction diffusion equations for ecology and related problems - Dynamics of front solutions in heterogeneous diffusive media http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5131&ko_name=Ikeda%2C+Hideo&paper_id=(Ikeda, Hideo) 2013-10-24 2013 NIMS-KMRS PDE Conference on reaction diffusion equations for ecology and related problems - A mathematical model of T helper cell differentiation http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4233&ko_name=%ED%99%A9%ED%98%95%EC%A3%BC&paper_id=&key_name=%ED%99%A9%ED%98%95%EC%A3%BC&key_locale=in(Hwang, Hyung Ju) 2013-10-24 2013 NIMS-KMRS PDE Conference on reaction diffusion equations for ecology and related problems - Spreading fronts of the disease in an SIS epidemic model http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5135&ko_name=Lin%2C+Zhigui&paper_id=(Lin,Zhigui) 2013-10-24 2013 NIMS-KMRS PDE Conference on reaction diffusion equations for ecology and related problems - Evolution of dispersal toward fitness and starvation driven diffusion http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2242&ko_name=%EA%B6%8C%EC%98%A4%EC%83%81&paper_id=&key_name=%EA%B6%8C%EC%98%A4%EC%83%81&key_locale=in(Kwon, Ohsang) 2013-10-24 2013 NIMS-KMRS PDE Conference on reaction diffusion equations for ecology and related problems - Dynamics of Localized Solutions for Reaction-Diffusion Systems on Curved Surface http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5138&ko_name=Ei%2C+Shin-Ichiro&paper_id=(Ei Shin-Ichiro) 2013-10-24 KAIST Special Lecture Series - Projective invariants of algebraic varieties Lecture 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4427&ko_name=Fyodor+L.+Zak&paper_id=(Fyodor Zak) 2013-10-24 2013 NIMS-KMRS PDE Conference on reaction diffusion equations for ecology and related problems - Influence of boundary conditions on the qualitative property of a reaction diffusion equation http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5139&ko_name=Lou%2C+Bendong&paper_id= (Bendong Lou) 2013-10-23 2013 NIMS-KMRS PDE Conference on reaction diffusion equations for ecology and related problems - Bacterial chemotaxis without gradient-sensing (Yoon, Changwook) 2013-10-23 2013 NIMS-KMRS PDE Conference on reaction diffusion equations for ecology and related problems - Persistent coexistence of cyclically competing species in spatially extended ecosystems http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4244&ko_name=%EB%8F%84%EC%98%81%ED%95%B4&paper_id=&key_name=%EB%8F%84%EC%98%81%ED%95%B4&key_locale=in(Do, Younghae) 2013-10-23 2013 NIMS-KMRS PDE Conference on reaction diffusion equations for ecology and related problems - A 2D-Model of Cell Sorting Induced by Propagation of Chemical Signals Along Spiral Waves http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4178&ko_name=%EA%B0%95%EA%B2%BD%EA%B7%BC&paper_id=&key_name=%EA%B0%95%EA%B2%BD%EA%B7%BC&key_locale=in(Kang,Kyungkeun) 2013-10-23 2013 NIMS-KMRS PDE Conference on reaction diffusion equations for ecology and related problems - Global dynamics of the two-species Lotka-Volterra competition-diffusion system http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5129&ko_name=He%2C+Xiaoqing&paper_id=(He, Xiaoqing) 2013-10-23 2013 NIMS-KMRS PDE Conference on reaction diffusion equations for ecology and related problems - Avoidance behavior in intraguild predation communities: A cross diffusion model http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5132&ko_name=Cantrell%2C+Robert+Ste&paper_id= (Cantrell, Robert Stephen) 2013-10-23 2013 NIMS-KMRS PDE Conference on reaction diffusion equations for ecology and related problems - On Hopf Bifurcation of Reaction-Diffusion Equations with Time Delay http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5136&ko_name=Wei%2C+Junjie&paper_id=(Wei, Junjie) 201310-22 2013 NIMS-KMRS PDE Conference on reaction diffusion equations for ecology and related problems - Does Toxicity Promote Coexistence? (Scotti, Tommaso) 2013-10-22 2013 NIMS-KMRS PDE Conference on reaction diffusion equations for ecology and related problems - Mathematical modeling of a random dispersal in heterogeneous environments http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4112&ko_name=%EA%B9%80%EC%9A%A9%EC%A0%95&paper_id=&key_name=%EA%B9%80%EC%9A%A9%EC%A0%95&key_locale=in(Kim, Yong-Jung) 2013-10-22 2013 NIMS-KMRS PDE Conference on reaction diffusion equations for ecology and related problems - Threshold dynamics for compartmental epidemic models with delays and related problems (Enatsu, Yoichi) 2013-10-22 2013 NIMS-KMRS PDE Conference on reaction diffusion equations for ecology and related problems - Structure on the set of radially symmetric positive stationary solutions for a competition-diffusion system http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5133&ko_name=Kanon%2C+Yukio&paper_id=(Yukio Kan-on) 2013-10-22 2013 NIMS-KMRS PDE Conference on reaction diffusion equations for ecology and related problems - Evolution of Dispersal in Heterogeneous Environments: Finding ESS http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5134&ko_name=Lou%2C+Yuan&paper_id=(Lou, Yuan) 2013-1022 - ( ) 2013-10-18 2013 KAIST Math. Colloquium - No Dice Conjecture http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3861&ko_name=%EC%9E%84%EC%9A%A9%EB%8F%84&paper_id=&key_locale=in(Yongdo Lim) 2013-10-17 KMRS Chair Professor Inaugural Lecture Series - Three Lectures on Existence theorems on isometric embedding for Riemannian manifolds III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4317&ko_name=Marshall+Slemrod&paper_id=(Marshall Slemrod) 2013-10-14 - The Geomorphic Theater and the Geochemical Play ( ) 2013-10-14 NIMS - Layer potential approaches to interface problems I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2161&ko_name=%EA%B0%95%ED%98%84%EB%B0%B0&paper_id=&key_locale=in(Hyeonbae Kang) 2013-10-11 NIMS - Layer potential approaches to interface problems II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2161&ko_name=%EA%B0%95%ED%98%84%EB%B0%B0&paper_id=&key_locale=in(Hyeonbae Kang) 2013-10-11 NIMS - Layer potential approaches to interface problems III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2161&ko_name=%EA%B0%95%ED%98%84%EB%B0%B0&paper_id=&key_locale=in(Hyeonbae Kang) 2013-10-11 - Challenges in Water Sustainability : Eawags Contributions and the Importance of Geochemistry (Prof. Janet G. Hering) 2013-10-11 KAIST Special Lecture Series - Lectures on irregular algebraic surfaces: Fibrations: the Xiao conjecture http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4768&ko_name=Gian+Pietro+Pirola&paper_id=(Gian Pietro Pirola) 2013-10-08 KAIST Special Lecture Series - Lectures on irregular algebraic surfaces: Paracanonical system http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4768&ko_name=Gian+Pietro+Pirola&paper_id=(Gian Pietro Pirola) 2013-10-08 KMRS Chair Professor Inaugural Lecture Series - Three Lectures on Existence theorems on isometric embedding for Riemannian manifolds II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4317&ko_name=Marshall+Slemrod&paper_id=(Marshall Slemrod) 2013-10-07 KMRS Chair Professor Inaugural Lecture Series - Three Lectures on Existence theorems on isometric embedding for Riemannian manifolds I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4317&ko_name=Marshall+Slemrod&paper_id=(Marshall Slemrod) 2013-10-04 The 17th International Workshop on Differential Geometry - Brief survey on the evolution of convex hypersurfaces by curvature functions (Hyunsuk Kang) 2013-10-02 The 17th International Workshop on Differential Geometry - Contact hypersurfaces in Kaehler manifolds II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4380&ko_name=Jurgen+Berndt&paper_id=(Jurgen Berndt) 2013-10-02 The 17th International Workshop on Differential Geometry - Some interesting families of non-Hopf real hypersurfaces in complex space forms http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5127&ko_name=Miguel+Dominguez-Vaz&paper_id=(Miguel Dominguez-Vazquez) 2013-10-02 The 17th International Workshop on Differential Geometry - Nonnegatively curved homogeneous spaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5125&ko_name=Kollross%2C+Andreas&paper_id=(Andreas Kollross) 2013-10-02 The 17th International Workshop on Differential Geometry - Scalar curvature decrease of some Riemannian metrics http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=249&ko_name=%EA%B9%80%EC%A2%85%EC%88%98&paper_id=&key_pos=%EC%84%9C%EA%B0%95%EB%8C%80&key_locale=in(Jongsu Kim) 2013-10-02 The 17th International Workshop on Differential Geometry - Deformations of associative submanifolds in nearly parallel G - manifolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5126&ko_name=Kotaro+Kawai&paper_id=(Kotaro Kawai) 2013-10-02 KMRS Chair Professor Inaugural Lecture Series - Two Lectures on Ghost Effect ll http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4317&ko_name=Marshall+Slemrod&paper_id=(Marshall Slemrod) 2013-10-02 The 17th International Workshop on Differential Geometry - On the minimality of the corresponding submanifolds to solvsolitons (Takahiro Hashinaga) 2013-10-01 The 17th International Workshop on Differential Geometry - Tha space of left-invariant metrics - on a generalization of Milnor frames http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3558&ko_name=Tamaru+Hiroshi&paper_id=TamaruH(Hiroshi Tamaru) 2013-10-01 The 17th International Workshop on Differential Geometry - Transnormal functions and transnormal systems http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4873&ko_name=Reiko+Miyaoka&paper_id=(Reiko Miyaoka) 2013-10-01 The 17th International Workshop on Differential Geometry - Ricci solitions in alomost contact geometry http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=1780&ko_name=%EC%A1%B0%EC%A2%85%ED%83%9D&paper_id=&key_pos=%EC%A0%84%EB%82%A8%EB%8C%80&key_locale=in(Jong Taek Cho) 2013-10-01 The 17th International Workshop on Differential Geometry - Quantum and Floer type cohomologies on almost contact metric manifolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=1762&ko_name=%EC%A1%B0%EC%9A%A9%EC%8A%B9&paper_id=&key_pos=%EC%9D%B4%ED%99%94&key_locale=in(Yong Seung Cho) 2013-10-01 The 17th International Workshop on Differential Geometry - On intersections of the Gauss images of isoparametric hypersurfaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4502&ko_name=Yoshihiro+Ohnita&paper_id=(Yoshihiro Ohnita) 2013-10-01 KAIST Special Lecture Series - Lectures on irregular algebraic surfaces: Castelnuovo - de Franchis theorem, Hodge numbers inequalities http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4768&ko_name=Gian+Pietro+Pirola&paper_id=(Gian Pietro Pirola) 2013-10-01 KAIST Special Lecture Series - Lectures on irregular algebraic surfaces: Lagrangian structure http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4768&ko_name=Gian+Pietro+Pirola&paper_id=(Gian Pietro Pirola) 2013-10-01 The 17th International Workshop on Differential Geometry - Fixed point sets of isometries and the intersection of real forms in a Hermitian symmertric space of compact type (Makiko Tanaka) 2013-09-30 The 17th International Workshop on Differential Geometry - Transversally harmonic maps between foliated Riemannian manifolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=1655&ko_name=%EC%A0%95%EC%8A%B9%EB%8B%AC&paper_id=&key_pos=%EC%A0%9C%EC%A3%BC%EB%8C%80%ED%95%99%EA%B5%90&key_locale=in(Seoung Dal Jung) 2013-09-30 The 17th International Workshop on Differential Geometry - Contact hypersurfaces in Kaehler manifolds I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4380&ko_name=Jurgen+Berndt&paper_id=(Jurgen Berndt) 2013-09-30 KMRS Chair Professor Inaugural Lecture Series - Two Lectures on Ghost Effect l http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4317&ko_name=Marshall+Slemrod&paper_id=(Marshall Slemrod) 2013-09-30 - ( ) 2013-09-27 2013 KAIST Math. Colloquium - Sphere packings, symplectic lattices and Riemann surfaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2086&ko_name=%ED%99%A9%EC%A4%80%EB%AC%B5&paper_id=&key_name=%ED%99%A9%EC%A4%80%EB%AC%B5&key_locale=in( ) 2013-09-26 2013 KAIST Math. Colloquium - Abstract harmonic analysis on compact quantum groups http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4580&ko_name=%EC%9D%B4%ED%9B%88%ED%9D%AC&paper_id=&key_name=%EC%9D%B4%ED%9B%88%ED%9D%AC&key_locale=in( ) 2013-09-12 KAIST- NIMS - Brain connectivity- based prediction of disease category (LeeDongSoo) 2013-08-29 KAIST- NIMS - Model- based approach in medical imaging (ChunSeYoung) 2013-08-29 KAIST- NIMS - SiPM PET- MR (ChoGyuSeong) 2013-08-29 KAIST- NIMS - Mathematics of CT http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1447&ko_name=%EC%9D%B4%EC%B0%BD%EC%98%A5&paper_id=&key_name=%EC%9D%B4%EC%B0%BD%EC%98%A5&key_locale=in(LeeChangOck) 2013-08-29 KAIST Special Lecture Series - Curve graphs for right-angled Artin groups II: the large and small scale geometry of the extension graph http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5076&ko_name=Thomas+Koberda&paper_id=(Thomas Koberda) 2013-07-11 KAIST Special Lecture Series - Curve graphs for right-angled Artin groups I: right-angled Artin group actions on the extension graph http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5076&ko_name=Thomas+Koberda&paper_id=(Thomas Koberda) 2013-07-09 The Asian Mathematical conference 2013 (AMC 2013) - Diophantine geometry and non-abelian motives http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4572&ko_name=%EA%B9%80%EB%AF%BC%ED%98%95&paper_id=&key_locale=in(Minhyong Kim) 2013-07-04 The Asian Mathematical conference 2013 (AMC 2013) - Wild ramification and the cotangent bundlev http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4509&ko_name=Takeshi+Saito&paper_id=(Takeshi Saito) 2013-07-03 The Asian Mathematical conference 2013 (AMC 2013) - Image Restoration: Wavelet Frame Approach, Total Variation and Beyond http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5081&ko_name=Zuowei+Shen&paper_id=(Zuowei Shen) 2013-07-03 The Asian Mathematical conference 2013 (AMC 2013) - Bridge: Backward stochastic differential equation, nonlinear expectation and path-dependent PDE http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5080&ko_name=Shige+Peng&paper_id=(Shige Peng) 2013-07-02 The Asian Mathematical conference 2013 (AMC 2013) - Wild harmonic bundles and some applications http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5082&ko_name=Takuro+Mochizuki&paper_id=(Takuro Mochizuki) 2013-07-02 The Asian Mathematical conference 2013 (AMC 2013) - Mathematics of Planet Earth http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5078&ko_name=Christiane+Rousseau&paper_id=(Christiane Rousseau) 2013-07-01 The Asian Mathematical conference 2013 (AMC 2013) - From particle to kinetic and hydrodynamic descriptions of flocking http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3955&ko_name=%ED%95%98%EC%8A%B9%EC%97%B4&paper_id=&key_locale=in(Seung Yeal Ha) 201307-01 The Asian Mathematical conference 2013 (AMC 2013) - Arithmetic of certain integrable system http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4483&ko_name=Ngo+Bao+Chau&paper_id=(B o Châu Ngô) 2013-07-01 The Asian Mathematical conference 2013 (AMC 2013) - Harmony and Matheamtics http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=377&ko_name=%EA%B9%80%ED%99%8D%EC%A2%85&paper_id=&key_locale=in(Kim, Hong-Jong) 2013-06-30 KAIST Special Lecture Series - Introduction to optimal Transportation I (6 28 ) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=142&ko_name=%EA%B9%80%EC%98%81%ED%97%8C&paper_id=&key_locale=in(Young-Heon Kim) 2013-06-28 KAIST Special Lecture Series - Introduction to optimal Transportation I (6 28 ) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=142&ko_name=%EA%B9%80%EC%98%81%ED%97%8C&paper_id=&key_locale=in(Young-Heon Kim) 2013-06-28 KAIST Special Lecture Series - Introduction to optimal Transportation I (6 26 ) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=142&ko_name=%EA%B9%80%EC%98%81%ED%97%8C&paper_id=&key_locale=in(Young-Heon Kim) 2013-06-26 KAIST Special Lecture Series - Introduction to optimal Transportation I (6 26 ) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=142&ko_name=%EA%B9%80%EC%98%81%ED%97%8C&paper_id=&key_locale=in(Young-Heon Kim) 2013-06-26 KAIST Special Lecture Series - Introduction to optimal Transportation I (6 25 ) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=142&ko_name=%EA%B9%80%EC%98%81%ED%97%8C&paper_id=&key_locale=in(Young-Heon Kim) 2013-06-25 KAIST Special Lecture Series - Introduction to optimal Transportation I (6 25 ) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=142&ko_name=%EA%B9%80%EC%98%81%ED%97%8C&paper_id=&key_locale=in(Young-Heon Kim) 2013-06-25 KAIST Special Lecture Series - Introduction to optimal Transportation I (6 24 ) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=142&ko_name=%EA%B9%80%EC%98%81%ED%97%8C&paper_id=&key_locale=in(Young-Heon Kim) 2013-06-24 KAIST Special Lecture Series - Introduction to optimal Transportation I (6 24 ) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=142&ko_name=%EA%B9%80%EC%98%81%ED%97%8C&paper_id=&key_locale=in(Young-Heon Kim) 2013-06-24 KAIST Special Lecture Series - Groups, Cell Complexes and l2-Homology http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5074&ko_name=Mineyev%2C+Igor&paper_id=(Igor Mineyev) 2013-06-14 - ( ) 2013-06-14 KAIST Special Lecture Series - Groups, Cell Complexes and l2-Homology http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5074&ko_name=Mineyev%2C+Igor&paper_id=(Igor Mineyev) 2013-06-12 KAIST Special Lecture Series - Groups, Cell Complexes and l2-Homology http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5074&ko_name=Mineyev%2C+Igor&paper_id=(Igor Mineyev) 2013-06-10 - GIS ( ) 2013-06-07 KAIST Special Lecture Series - (Baek HongYeol) 2013-06-05 KAIST Special Lecture Series - Groups, Cell Complexes and l2-Homology http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5074&ko_name=Mineyev%2C+Igor&paper_id=(Igor Mineyev) 2013-06-05 KAIST Special Lecture Series - Groups, Cell Complexes and l2-Homology http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5074&ko_name=Mineyev%2C+Igor&paper_id=(Igor Mineyev) 2013-06-03 KAIST Special Lecture Series - Groups, Cell Complexes and l2-Homology http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5074&ko_name=Mineyev%2C+Igor&paper_id=(Igor Mineyev) 2013-05-31 - New challenge of real-time ocean observation using geostationary ocean color imager ( ) 2013-05-31 KAIST Special Lecture Series - Groups, Cell Complexes and l2-Homology http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5074&ko_name=Mineyev%2C+Igor&paper_id=(Igor Mineyev) 2013-05-29 KAIST Special Lecture Series - Groups, Cell Complexes and l2-Homology http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5074&ko_name=Mineyev%2C+Igor&paper_id=(Igor Mineyev) 2013-05-27 KAIST Special Lecture Series - Geometry of projective surfaces 5 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5075&ko_name=Ranestad%2C+Kristian&paper_id=(Kristian Ranestad) 2013-05-24 KAIST Special Lecture Series - Geometry of projective surfaces 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5075&ko_name=Ranestad%2C+Kristian&paper_id=(Kristian Ranestad) 2013-05-22 KAIST Special Lecture Series - Geometry of projective surfaces 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5075&ko_name=Ranestad%2C+Kristian&paper_id=(Kristian Ranestad) 2013-05-20 2013 KAIST Math. Colloquium - Powersum decompositions of symmetric tensors http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5075&ko_name=Ranestad%2C+Kristian&paper_id=(Kristian Ranestad) 2013-05-16 KMRS Chair Professor Inaugural Lecture Series - Tropicalization of Classical Moduli Spaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Bernd Stumfels) 2013-05-15 KAIST Special Lecture Series - Geometry of projective surfaces 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5075&ko_name=Ranestad%2C+Kristian&paper_id=(Kristian Ranestad) 2013-05-15 KMRS Chair Professor Inaugural Lecture Series - Maximum Likelihood for Matrices with Rank Constraints http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Bernd Stumfels) 2013-05-13 KAIST Special Lecture Series - Geometry of projective surfaces 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5075&ko_name=Ranestad%2C+Kristian&paper_id=(Kristian Ranestad) 2013-05-13 KMRS Chair Professor Inaugural Lecture Series - The Central Curve in Linear Programming http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4246&ko_name=Bernd+Sturmfels&paper_id=(Bernd Stumfels) 2013-05-10 - 8 -17 ( ) 2013-05-10 2013 KAIST Math. Colloquium - Left-orderability of 3-manifold groups http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5083&ko_name=Cameron+Gordon&paper_id=(Cameron Gordon) 2013-05-09 - R&D ( ) 2013-04-19 2013 KAIST Math. Colloquium - Introduction to Discrete Partial Differential Equations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1654&ko_name=%EC%A0%95%EC%88%9C%EC%98%81&paper_id=&key_locale=in(Chung, Soon-Yeong) 2013-04-18 KMRS Seminar - Quasiconvex subgroups and Dehn filling http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4541&ko_name=Jason+F.+Manning&paper_id=(Jason Fox Manning) 2013-04-16 KMRS Seminar - The relatively hyperbolic Dehn filling theorem http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4541&ko_name=Jason+F.+Manning&paper_id=(Jason Fox Manning) 2013-04-12 KMRS Seminar - Relatively hyperbolic groups http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4541&ko_name=Jason+F.+Manning&paper_id=(Jason Fox Manning) 2013-04-11 2013 KAIST Math. Colloquium - THE STRUCTURE OF THE MANDELBROT SET http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5084&ko_name=John+Hubbard&paper_id=(John Hubbard) 2013-03-28 - Advanced Minerals Characterization Capabilities at CSIRO - A Mineral Sands Case Study. (Dr. Mark Pownceby) 2013-03-15 - Tectonometamorphic evolution of collisional Songrim orogeny : Insights from the Pyeongan Supergroup in northeastern flank of the Taebaeksan Basin. ( ) 2013-03-15 - Progress on the Management of Water Resources Using controlled-release Systems ( ) 2013-03-08 The Arithmetic of Function Fields and Related Topics - The maximum weight of cross-t intersecting families http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5085&ko_name=%EC%9D%B4%EC%83%81%EC%A4%80&paper_id=&key_locale=in(Sang June Lee) 2013-02-21 The Arithmetic of Function Fields and Related Topics - Class groups under relative quadratic extensions http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4272&ko_name=Qin+Yue&paper_id=(Qin Yue) 2013-02-21 The Arithmetic of Function Fields and Related Topics - Some Results on Harmonic Analysis on Siegel-Jacobi Space http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=964&ko_name=%EC%96%91%EC%9E%AC%ED%98%84&paper_id=&key_locale=in(Jae-Hyun Yang) 2013-02-21 The Arithmetic of Function Fields and Related Topics - On automorphisms of prime order of Riemann surfaces, function fields, or algebraic curves http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4561&ko_name=Andreas+Schweizer&paper_id=(Andreas Schweizer) 2013-02-20 The Arithmetic of Function Fields and Related Topics - Moebius function in short intervals for function fields http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4037&ko_name=%EC%A0%95%ED%99%98%EC%97%BD&paper_id=&key_name=%EC%A0%95%ED%99%98%EC%97%BD&key_locale=in(Hwanyup Jung) 2013-02-20 The Arithmetic of Function Fields and Related Topics - Diophantine approximation in fields of formal power series over finite fields. (Huei Jeng Chen) 2013-02-20 The Arithmetic of Function Fields and Related Topics - Optimal quotients of Mumford curves and component groups http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4910&ko_name=Mihran+Papikian&paper_id=(Mihran Papikian) 2013-02-20 The Arithmetic of Function Fields and Related Topics - Theta constant of odd levels http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5087&ko_name=%EC%97%84%EC%9D%B5%EC%84%A0&paper_id=&key_locale=in(Ick Sun Eum) 2013-02-20 The Arithmetic of Function Fields and Related Topics - Drinfeld modular forms and modular representation theory http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4551&ko_name=Ernst+Urlich+Gekeler&paper_id=(Ernst Urlich Gekeler) 2013-02-20 The Arithmetic of Function Fields and Related Topics - Determining Whitmans generalized cyclotomic numbers of order 4 (Xiao-Meng Zhu) 2013-02-19 The Arithmetic of Function Fields and Related Topics - Canonical models of modular curves http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3888&ko_name=%EA%B9%80%EC%B0%BD%ED%97%8C&paper_id=&key_pos=%ED%95%9C%EC%96%91%EB%8C%80&key_locale=in(Changheon Kim) 2013-02-19 The Arithmetic of Function Fields and Related Topics - Rational points on curves over finite fields and Drinfeld modular varieties http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4906&ko_name=Alp+Bassa&paper_id=(Alp Bassa) 2013-02-19 The Arithmetic of Function Fields and Related Topics - Shift operators and two applications to $\Fq[[T]]$ http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3716&ko_name=%EC%A0%95%EC%83%81%ED%83%9C&paper_id=&key_locale=in(Sangtae Jeong) 2013-02-19 The Arithmetic of Function Fields and Related Topics - Automorphic forms of Drinfeld type and the basis problem. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4650&ko_name=Jing+Yu&paper_id=(Jing Yu) 2013-02-19 The Arithmetic of Function Fields and Related Topics - Explicit isogeny theorems and different bounds of Drinfeld modules http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=1337&ko_name=%EC%9D%B4%EC%9C%A4%EC%A7%84&paper_id=&key_name=%EC%9D%B4%EC%9C%A4%EC%A7%84&key_locale=in(Yoonjin Lee) 2013-02-19 The Arithmetic of Function Fields and Related Topics - Counting dihedral and quaternionic extensions in function fields http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3702&ko_name=%EC%95%88%EC%9E%AC%ED%98%84&paper_id=&key_name=%EC%95%88%EC%9E%AC%ED%98%84&key_locale=in(Jaehyun Ahn) 2013-02-18 The Arithmetic of Function Fields and Related Topics - On A-expansions of Drinfeld modular forms and vectorial Drinfeld modular forms. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5088&ko_name=Alexandar+Petrov&paper_id=(Alexandar Petrov) 2013-02-18 The Arithmetic of Function Fields and Related Topics - Infinite families of elliptic curves over Dihedral quartic number fields http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4071&ko_name=%EC%A0%84%EB%8C%80%EC%97%B4&paper_id=&key_locale=in(Daeyeol Jeon) 2013-02-18 The Arithmetic of Function Fields and Related Topics - On congruences of Galois representations of global fields http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4562&ko_name=Yuichiro+Taguchi&paper_id=(Yuichiro Taguchi) 2013-02-18 The Arithmetic of Function Fields and Related Topics - The zeros of certain weakly holomorphic Drinfeld modular forms http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4005&ko_name=%EC%B5%9C%EC%86%8C%EC%98%81&paper_id=&key_locale=in(Soyoung Choi) 2013-02-18 ASARC Seminar - Upper bounds for higher linear syzygies of projective varieties (II) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5089&ko_name=%ED%95%9C%EA%B0%95%EC%A7%84&paper_id=&key_name=%ED%95%9C%EA%B0%95%EC%A7%84&key_pos=%ED%95%9C%EA%B5%AD%EA%B3%A0%EB%93%B1%EA%B3%BC%ED%9(Han, Kangjin) 2013-01-30 ASARC Seminar - Higher secant varieties, defectiveness and equations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4912&ko_name=Giorgio+Ottaviani&paper_id=(Giorgio Ottaviani) 2013-01-30 ASARC Seminar - Upper bounds for higher linear syzygies of projective varieties (I) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5089&ko_name=%ED%95%9C%EA%B0%95%EC%A7%84&paper_id=&key_name=%ED%95%9C%EA%B0%95%EC%A7%84&key_pos=%ED%95%9C%EA%B5%AD%EA%B3%A0%EB%93%B1%EA%B3%BC%ED%9(Han, Kangjin) 2013-01-28 ASARC Seminar - Projective varieties with nonbirational centers http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4384&ko_name=Atsushi+Noma&paper_id=(Atsushi Noma) 2013-01-28 ASARC Seminar - Counter examples to Prym-Torelli with high Clifford index http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4467&ko_name=Herbert+Lange&paper_id=(Herbert Lange) 2013-01-26 2013 KAIST Winter School on Algebraic Geometry - Log minimal model program of $\overline M_g$ via GIT and stacks 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4911&ko_name=Maksym+Fedorchuk&paper_id=(Maksym Fedorchuk) 2013-01-25 2013 KAIST Winter School on Algebraic Geometry - Beilinson theorem and syzygies 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4912&ko_name=Giorgio+Ottaviani&paper_id=(Giorgio Ottaviani) 2013-01-25 2013 KAIST Winter School on Algebraic Geometry - Prym varieties 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4467&ko_name=Herbert+Lange&paper_id=(Herbert Lange) 2013-01-25 2013 KAIST Winter School on Algebraic Geometry - Generic inner projections of projective varieties and an application to the positivity of double point divisors 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4384&ko_name=Atsushi+Noma&paper_id=(Atsushi Noma) 2013-01-24 2013 KAIST Winter School on Algebraic Geometry - Log minimal model program of $\overline M_g$ via GIT and stacks 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4911&ko_name=Maksym+Fedorchuk&paper_id=(Maksym Fedorchuk) 2013-01-24 2013 KAIST Winter School on Algebraic Geometry - Beilinson theorem and syzygies 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4912&ko_name=Giorgio+Ottaviani&paper_id=(Giorgio Ottaviani) 2013-01-24 2013 KAIST Winter School on Algebraic Geometry - Prym varieties 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4467&ko_name=Herbert+Lange&paper_id=(Herbert Lange) 2013-01-24 2013 KAIST Winter School on Algebraic Geometry - Beilinson theorem and syzygies 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4912&ko_name=Giorgio+Ottaviani&paper_id=(Giorgio Ottaviani) 2013-01-23 2013 KAIST Winter School on Algebraic Geometry - Log minimal model program of $\overline M_g$ via GIT and stacks 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4911&ko_name=Maksym+Fedorchuk&paper_id=(Maksym Fedorchuk) 2013-01-23 2013 KAIST Winter School on Algebraic Geometry - Generic inner projections of projective varieties and an application to the positivity of double point divisors 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4384&ko_name=Atsushi+Noma&paper_id=(Atsushi Noma) 2013-01-23 2013 KAIST Winter School on Algebraic Geometry - Prym varieties 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4467&ko_name=Herbert+Lange&paper_id=(Herbert Lange) 2013-01-23 ASARC Seminar - An introduction to the log minimal model program for the moduli space of curves http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4911&ko_name=Maksym+Fedorchuk&paper_id=(Maksym Fedorchuk) 2013-01-22 KAIST Discrete Math Seminar - The critical window for the Ramsey-Turan problem http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4934&ko_name=Po-Shen+Loh&paper_id=(Po-Shen Loh) 2013-01-11 Korea PDE School #3 - Global entropy solutions to a quasilinear hyperbolic system modeling blood flow http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4899&ko_name=Tong+Li&paper_id=(Tong Li) 2013-01-11 Korea PDE School #3 - Navier-Stokes equations 5 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1949&ko_name=%EC%B5%9C%ED%9D%AC%EC%A4%80&paper_id=&key_name=%EC%B5%9C%ED%9D%AC%EC%A4%80&key_locale=in(Choe, Hi Jun) 2013-01-11 Korea PDE School #3 - Regularity theory for elliptic and parabolic equations 5 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4898&ko_name=Lihe+Wang&paper_id=(Lihe Wang) 2013-01-11 Korea PDE School #3 - Global existence of weak solutions for a Keller-Segel-fluid model with nonlinear diffusion http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4178&ko_name=%EA%B0%95%EA%B2%BD%EA%B7%BC&paper_id=&key_name=%EA%B0%95%EA%B2%BD%EA%B7%BC&key_locale=in(Kang, Kyung-Keun) 2013-01-10 Korea PDE School #3 - Starvation driven diffusion as a survival strategy of biological organisms http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4112&ko_name=%EA%B9%80%EC%9A%A9%EC%A0%95&paper_id=&key_name=%EA%B9%80%EC%9A%A9%EC%A0%95&key_locale=in(Kim, Yongjung) 2013-01-10 Korea PDE School #3 - Application of reaction-diffusion systems to biological and chemical systems 5 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4897&ko_name=Masayasu+Mimura&paper_id=(Masayasu Mimura) 2013-01-10 Korea PDE School #3 - Regularity theory for elliptic and parabolic equations 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4898&ko_name=Lihe+Wang&paper_id=(Lihe Wang) 2013-01-10 Korea PDE School #3 - Application of reaction-diffusion systems to biological and chemical systems 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4897&ko_name=Masayasu+Mimura&paper_id=(Masayasu Mimura) 2013-01-09 Korea PDE School #3 - Mathematical analysis of the stationary motion of an incompressible viscous fluid http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4091&ko_name=%EA%B9%80%ED%98%84%EC%84%9D&paper_id=&key_name=%EA%B9%80%ED%98%84%EC%84%9D&key_locale=in(Kim, Hyunseok) 2013-01-09 Korea PDE School #3 - Navier-Stokes equations 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1949&ko_name=%EC%B5%9C%ED%9D%AC%EC%A4%80&paper_id=&key_name=%EC%B5%9C%ED%9D%AC%EC%A4%80&key_locale=in(Choe, Hi Jun) 2013-01-09 Korea PDE School #3 - Examples of shock solutions for Euler system http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4900&ko_name=%EB%B0%B0%EB%AA%85%EC%A7%84&paper_id=&key_name=%EB%B0%B0%EB%AA%85%EC%A7%84&key_locale=in(Bae, Myoungjean) 2013-01-09 Korea PDE School #3 - Application of reaction-diffusion systems to biological and chemical systems 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4897&ko_name=Masayasu+Mimura&paper_id=(Masayasu Mimura) 2013-01-09 Korea PDE School #3 - Navier-Stokes equations 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1949&ko_name=%EC%B5%9C%ED%9D%AC%EC%A4%80&paper_id=&key_name=%EC%B5%9C%ED%9D%AC%EC%A4%80&key_locale=in(Choe, Hi Jun) 2013-01-09 Korea PDE School #3 - Regularity theory for elliptic and parabolic equations 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4898&ko_name=Lihe+Wang&paper_id=(Lihe Wang) 2013-01-08 Korea PDE School #3 - Application of reaction-diffusion systems to biological and chemical systems 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4897&ko_name=Masayasu+Mimura&paper_id=(Masayasu Mimura) 2013-01-08 Korea PDE School #3 - Navier-Stokes equations 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1949&ko_name=%EC%B5%9C%ED%9D%AC%EC%A4%80&paper_id=&key_name=%EC%B5%9C%ED%9D%AC%EC%A4%80&key_locale=in(Choe, Hi Jun) 2013-01-08 Korea PDE School #3 - Regularity theory for elliptic and parabolic equations 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4898&ko_name=Lihe+Wang&paper_id=(Lihe Wang) 2013-01-08 Korea PDE School #3 - Regularity theory for elliptic and parabolic equations 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4898&ko_name=Lihe+Wang&paper_id=(Lihe Wang) 2013-01-07 Korea PDE School #3 - Navier-Stokes equations 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1949&ko_name=%EC%B5%9C%ED%9D%AC%EC%A4%80&paper_id=&key_name=%EC%B5%9C%ED%9D%AC%EC%A4%80&key_locale=in(Choe, Hi Jun) 2013-01-07 Korea PDE School #3 - Application of reaction-diffusion systems to biological and chemical systems 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4897&ko_name=Masayasu+Mimura&paper_id=(Masayasu Mimura) 2013-01-07 2013 Korea Toric Topology Winter Worksohp - Some properties of the permutation tableaux of type B (Park, Kyoungsuk) 2013-01-04 KAIST Discrete Math Seminar - Ramsey numbers of cubes versus cliques http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4901&ko_name=Lee%2C+Choongbum&paper_id=(Lee, Choongbum) 2013-01-04 2013 Korea Toric Topology Winter Worksohp - $T^2$-cobordism of quasitoric 4-manifolds (Soumen Sarkar) 2013-01-04 2013 Korea Toric Topology Winter Worksohp - Combinatorial properties of subspace arrangements http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5057&ko_name=%EA%B9%80%EC%83%81%EC%9A%B1&paper_id=&key_name=%EA%B9%80%EC%83%81%EC%9A%B1&key_locale=in(Kim, Sangwook) 2013-01-04 2013 Korea Toric Topology Winter Worksohp - Small covers over polytopes with a few facets http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5095&ko_name=%EB%B0%95%ED%95%9C%EC%B2%A0&paper_id=&key_name=%EB%B0%95%ED%95%9C%EC%B2%A0&key_locale=in(Park, Hanchul) 2013-01-04 2013 Korea Toric Topology Winter Worksohp - M(J)-manifolds and its rigidity problem http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5091&ko_name=%EC%86%A1%EC%A2%85%EB%B0%B1&paper_id=&key_name=%EC%86%A1%EC%A2%85%EB%B0%B1&key_locale=in(Song, Jongbaek) 2013-01-04 2013 Korea Toric Topology Winter Worksohp - (Factorial) Schur functions and weighted Grassmannians http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5090&ko_name=Tomoo+Matsumura&paper_id=(Tomoo Matsumura) 2013-01-04 2013 Korea Toric Topology Winter Worksohp - Computing signed a-polynomials of complete multipartite graphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4511&ko_name=%EC%8B%A0%ED%9D%AC%EC%84%B1&paper_id=&key_name=%EC%8B%A0%ED%9D%AC%EC%84%B1&key_locale=in(Shin, Heesung) 2013-01-03 2013 Korea Toric Topology Winter Worksohp - Strong cohomological rigidity of quasitoric manifolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5092&ko_name=%EB%B0%95%EC%84%A0%EC%A0%95&paper_id=&key_name=%EB%B0%95%EC%84%A0%EC%A0%95&key_locale=in(Park, Seonjeong) 2013-01-03 Back to top of page 2012 KAIST Discrete Math Seminar - The list version of the Borodin-Kostochka Conjecture for graphs with large maximum degree http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5096&ko_name=%EC%B5%9C%EC%9D%BC%EA%B7%9C&paper_id=&key_locale=in(Choi, Ilkyoo) 201212-27 - Coupled biological and geochemical processes contributing to iron, sulfate, and uranium reduction in subsurface environment ( ) 2012-12-27 - ( ) 2012-12-27 Hot Topics International Workshop on The Mathematics of Materials Science : Liquid Crystals and Related Topics - Asymptotic self-similarity in semilinear elliptic equations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=692&ko_name=%EB%B0%B0%EC%88%98%ED%98%84&paper_id=&key_name=%EB%B0%B0%EC%88%98%ED%98%84&key_locale=in(Bae, Soohyun) 2012-12-22 Hot Topics International Workshop on The Mathematics of Materials Science : Liquid Crystals and Related Topics - Surface Superconducting States versus Surface Smectic States http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4894&ko_name=Xingbin+Pan&paper_id=(Xingbin Pan) 201212-22 Hot Topics International Workshop on The Mathematics of Materials Science : Liquid Crystals and Related Topics - The Liquid Crystal flow for the Oseen-Frank model. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4891&ko_name=Min-Chun+Hong&paper_id=(Hong, Minchun) 201212-22 Hot Topics International Workshop on The Mathematics of Materials Science : Liquid Crystals and Related Topics - From Molecular Symmetry to Order Parameters http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4895&ko_name=Pingwen+Zhang&paper_id=(Pingwen Zhang) 2012-12-22 Hot Topics International Workshop on The Mathematics of Materials Science : Liquid Crystals and Related Topics - Mathematical issues relating to the Landau – de Gennes theory of liquid crystals II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4890&ko_name=John+MacLeod+Ball&paper_id=(John Ball) 2012-12-22 Hot Topics International Workshop on The Mathematics of Materials Science : Liquid Crystals and Related Topics - Chern-Simons limit of the standing wave solutions for the Schrodinger equations coupled with a neutral scalar field http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4188&ko_name=%ED%95%9C%EC%A2%85%EB%AF%BC&paper_id=&key_name=%ED%95%9C%EC%A2%85%EB%AF%BC&key_locale=in(Han, Jongmin) 2012-12-22 Hot Topics International Workshop on The Mathematics of Materials Science : Liquid Crystals and Related Topics - Undulations in smecitc A liquid crystals http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5099&ko_name=%EC%A3%BC%EC%88%98%EA%B2%BD&paper_id=&key_locale=in(Joo, Sookyung) 2012-12-21 Hot Topics International Workshop on The Mathematics of Materials Science : Liquid Crystals and Related Topics - Blow-up criterion for the simplied Ericksen-Leslie model and related equations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3795&ko_name=%EC%9D%B4%EC%A7%80%ED%9B%88&paper_id=&key_name=%EC%9D%B4%EC%A7%80%ED%9B%88&key_locale=in(Lee, Jihoon) 2012-12-21 Hot Topics International Workshop on The Mathematics of Materials Science : Liquid Crystals and Related Topics - Biaxial defect cores in nematic equilibria:an asymptotic result http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4892&ko_name=Apala+Majumdar&paper_id=(Apala Majumdar) 2012-12-21 Hot Topics International Workshop on The Mathematics of Materials Science : Liquid Crystals and Related Topics - On the blow-up problem for the Euler equations and the Liouville type results for the fluid equations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=1831&ko_name=%EC%B1%84%EB%8F%99%ED%98%B8&paper_id=&key_name=%EC%B1%84%EB%8F%99%ED%98%B8&key_locale=in(Chae, Dongho) 2012-12-21 Hot Topics International Workshop on The Mathematics of Materials Science : Liquid Crystals and Related Topics - Viscoelasticity of rod-like polymers in nematic solutions. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5098&ko_name=Masao+Doi&paper_id=(Masao Doi) 2012-12-21 Hot Topics International Workshop on The Mathematics of Materials Science : Liquid Crystals and Related Topics - Mathematical issues relating to the Landau – de Gennes theory of liquid crystals I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4890&ko_name=John+MacLeod+Ball&paper_id=(John Ball) 2012-12-21 Hot Topics International Workshop on The Mathematics of Materials Science : Liquid Crystals and Related Topics - Modeling the Dynamics of Liquid Crystalline Systems http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4893&ko_name=Peter+Palffy-Muhoray&paper_id=(Peter PalffyMuhoray) 2012-12-21 Hot Topics International Workshop on The Mathematics of Materials Science : Liquid Crystals and Related Topics - Enhancement of near-cloaking http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4320&ko_name=%EC%9E%84%EB%AF%B8%EA%B2%BD&paper_id=&key_name=%EC%9E%84%EB%AF%B8%EA%B2%BD&key_locale=in(Lim, Mikyung) 2012-12-20 KAIST Discrete Math Seminar - Diagrams, balanced labellings and affine Stanley symmetric functions http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5100&ko_name=%EC%9C%A0%ED%99%98%EC%B2%A0&paper_id=&key_locale=in(Yoo, Hwanchul) 2012-12-20 Hot Topics International Workshop on The Mathematics of Materials Science : Liquid Crystals and Related Topics - On the global existence of strong solutions to the Cucker-Smale-Navier-Stokes system http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3955&ko_name=%ED%95%98%EC%8A%B9%EC%97%B4&paper_id=&key_name=%ED%95%98%EC%8A%B9%EC%97%B4&key_locale=in(Ha, Seungyeal) 2012-12-20 Hot Topics International Workshop on The Mathematics of Materials Science : Liquid Crystals and Related Topics - Brownian motion and viscoelasticity of rod-like polymers in isotropic solutions. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5098&ko_name=Masao+Doi&paper_id=(Masao Doi) 2012-12-20 Hot Topics International Workshop on The Mathematics of Materials Science : Liquid Crystals and Related Topics - A Brief Introduction to Liquid Crystals http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4893&ko_name=Peter+Palffy-Muhoray&paper_id=(Peter Palffy-Muhoray) 2012-12-20 Hot Topic Workshop on Fuzzy Theory and Applications - Fuzzy least squares estimation with new operations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5103&ko_name=%EC%9C%A4%EC%A7%84%ED%9D%AC&paper_id=&key_name=%EC%9C%A4%EC%A7%84%ED%9D%AC&key_locale=in(Yoon, Jinhee) 2012-12-14 Hot Topic Workshop on Fuzzy Theory and Applications - Z-number, Introduction and Engineering Applications (Peiman Pazhoheshfar) 2012-12-14 Hot Topic Workshop on Fuzzy Theory and Applications - A Fuzzy Mathematical Framework for Integrated Knowledge Discovery and Synthesis through Multi-Hetero Information Sources http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5101&ko_name=Morteza+Saberi&paper_id=(Morteza Saberi) 2012-12-14 Hot Topic Workshop on Fuzzy Theory and Applications - Why is Uncertainty Theory Useful? http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4881&ko_name=Baoding+Liu&paper_id=(Baodong Liu) 2012-12-14 Hot Topic Workshop on Fuzzy Theory and Applications - A study on the fuzzy prediction and identification systems based on the rough sets (Bang, Younkeun) 2012-12-13 KAIST GRAPH THEORY DAY 2012 - Quasi-randomness and property testing of permutations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4396&ko_name=Daniel+Kral%E2%80%99&paper_id=(Daniel Král') 2012-12-13 2012 KAIST Mathh Colloquium - Quasi-randomness and property testing of permutations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4396&ko_name=Daniel+Kral%E2%80%99&paper_id=(Daniel Král') 2012-12-13 Hot Topic Workshop on Fuzzy Theory and Applications - On Abelian and Related Fuzzy Subsets of Groupoids http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=387&ko_name=%EA%B9%80%ED%9D%AC%EC%8B%9D&paper_id=&key_name=%EA%B9%80%ED%9D%AC%EC%8B%9D&key_locale=in(Kim, Heesik) 2012-12-13 KAIST GRAPH THEORY DAY 2012 - Excluding paths and antipaths http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4454&ko_name=Maria+Chudnovsky&paper_id=(Maria Chudnovsky) 2012-12-13 KAIST GRAPH THEORY DAY 2012 - Graphs, tournaments, colouring and containment http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4453&ko_name=Paul+Seymour&paper_id=(Paul Seymour) 2012-12-13 KAIST GRAPH THEORY DAY 2012 - Applications of the matroid-complex intersection theorems http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4889&ko_name=Tom%C3%A1%C5%A1+Kaiser&paper_id=(Tomáš Kaiser) 2012-12-13 Hot Topic Workshop on Fuzzy Theory and Applications - Fuzzy Transform - A Powerful Soft Computing Technique http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5104&ko_name=Irina+Perfilieva&paper_id=(Irina Perfilieva) 2012-12-13 Hot Topic Workshop on Fuzzy Theory and Applications - On a consistent operator system and its application http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4885&ko_name=Jozsef+Dombi&paper_id=(J´ozsef Dombi) 2012-12-13 Hot Topic Workshop on Fuzzy Theory and Applications - Some Robust Fuzzy Regression Models http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4883&ko_name=Seyed+Mahmoud+Taheri&paper_id=(S. Mahmoud Taheri) 2012-12-13 Hot Topic Workshop on Fuzzy Theory and Applications - Fuzzy regression analysis using bootstrap techniques http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5108&ko_name=%EC%9D%B4%EC%9A%B0%EC%A3%BC&paper_id=&key_pos=%EC%97%B0%EC%84%B8%EB%8C%80%ED%95%99%EA%B5%90&key_locale=in(Lee, Woojoo) 2012-12-12 Hot Topic Workshop on Fuzzy Theory and Applications - Likelihood Inference based on Fuzzy Data in Regression Model http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5107&ko_name=%EC%A0%95%ED%98%9C%EC%98%81&paper_id=&key_name=%EC%A0%95%ED%98%9C%EC%98%81&key_locale=in(Jung, Hyeyoung) 2012-12-12 Hot Topic Workshop on Fuzzy Theory and Applications - Explaining the Determinants of Credit Default Swap Premium with the Elasticity of Variance. (Choi, Sunyoung) 2012-12-12 Hot Topic Workshop on Fuzzy Theory and Applications - Option pricing under stochastic elasticity of variance and statistics of the elasticity (Yoon, Jihun) 2012-12-12 Hot Topic Workshop on Fuzzy Theory and Applications - Connectedness and Spillover among International Stock Market http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5105&ko_name=%EA%B9%80%EC%9A%B0%ED%99%98&paper_id=&key_pos=%EC%97%B0%EC%84%B8%EB%8C%80&key_locale=in(Kim, Woohwan) 2012-12-12 Hot Topic Workshop on Fuzzy Theory and Applications - Implementation of Fuzzy Logic Systems by Nanotechnology (Martin Klimo) 2012-12-12 Hot Topic Workshop on Fuzzy Theory and Applications - Fuzzy Random Variable Approach to Regression Analysis http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4884&ko_name=Junzo+Watada&paper_id=(Junzo Watada) 2012-12-12 Hot Topic Workshop on Fuzzy Theory and Applications - Fuzzy Natural Logic : Beginning of a Long Path http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4882&ko_name=Vilem+Novak&paper_id=(Vilem Novak) 2012-12-12 ASARC Seminar - Tensor structure on smooth motives http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4888&ko_name=Anandam+Banerjee&paper_id=(Anandam Banerjee) 2012-12-11 KAIST Discrete Math Seminar - Simplifying inclusion-exclusion formulas http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4661&ko_name=Xavier+Goaoc&paper_id=(Xavier Goaoc) 2012-12-07 ASARC Seminar - Rost nilpotence and Chow motives http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4880&ko_name=Stefan+Gille&paper_id=(Stefan Gille) 2012-12-06 ASARC Seminar - On the Brauer group of a product of certain varieties with a torus http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4880&ko_name=Stefan+Gille&paper_id=(Stefan Gille) 2012-12-04 Seoul-Tokyo Conference Elliptic and Parabolic PDEs and Related Topics - Highly oscillating thin obstacles http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5111&ko_name=%EC%9C%A0%EB%AF%BC%ED%95%98&paper_id=&key_name=%EC%9C%A0%EB%AF%BC%ED%95%98&key_locale=in(Yoo, Minha) 2012-12-01 Seoul-Tokyo Conference Elliptic and Parabolic PDEs and Related Topics - Asymptotically self-similar solutions to curvature flow equations with prescribed contact angle http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5110&ko_name=Nao+Hamamuki&paper_id=(Nao Hamamuki) 2012-1201 Seoul-Tokyo Conference Elliptic and Parabolic PDEs and Related Topics - Mathematical analysis for several inverse problems for fractional diffusion equations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4879&ko_name=Masahiro+Yamamoto&paper_id=(Masahiro Yamamoto) 2012-1201 Seoul-Tokyo Conference Elliptic and Parabolic PDEs and Related Topics - Existence results about the nonlinear schrodinger-poisson equations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5109&ko_name=%EC%84%9D%EC%A7%84%EB%AA%85&paper_id=&key_name=%EC%84%9D%EC%A7%84%EB%AA%85&key_locale=in(Seok, Jinmyoung) 2012-12-01 Seoul-Tokyo Conference Elliptic and Parabolic PDEs and Related Topics - Mathematical analysis of a 3D model of cellular electrophysiology http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4878&ko_name=Hiroshi+Matano&paper_id=(Hiroshi Matano) 2012-12-01 Seoul-Tokyo Conference Elliptic and Parabolic PDEs and Related Topics - Asymptotic Behavior in Parabolic Fully Nonlinear equations and its application to Elliptic Eigenvalue Problems (Kim, Soojung) 2012-11-30 Seoul-Tokyo Conference Elliptic and Parabolic PDEs and Related Topics - Stokes resolvent estimates in spaces of bounded functions (Ken Abe) 2012-11-30 Seoul-Tokyo Conference Elliptic and Parabolic PDEs and Related Topics - Global existence of Navier-Stokes-Vlaosv Fokker-Planck equations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3795&ko_name=%EC%9D%B4%EC%A7%80%ED%9B%88&paper_id=&key_name=%EC%9D%B4%EC%A7%80%ED%9B%88&key_locale=in(Lee, Jihoon) 2012-11-30 Seoul-Tokyo Conference Elliptic and Parabolic PDEs and Related Topics - On a diffuse interface model for non-Newtonian fluids with matched densities http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5113&ko_name=Yutaka+Terasawa&paper_id=(Yutaka Terasawa) 2012-11-30 Seoul-Tokyo Conference Elliptic and Parabolic PDEs and Related Topics - Regularity theory on nonlinear integro-differential operators http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3937&ko_name=%EC%9D%B4%EA%B8%B0%EC%95%94&paper_id=&key_name=%EC%9D%B4%EA%B8%B0%EC%95%94&key_locale=in(Lee, Ki-Ahm) 2012-11-30 Seoul-Tokyo Conference Elliptic and Parabolic PDEs and Related Topics - Homogenization of a Hele-Shaw-type problem in periodic timedependent media http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5112&ko_name=Norbert+Pozar&paper_id=(Norbert Pozar) 2012-11-30 2012 KAIST Mathh Colloquium - On the blow-up problem for the Euler equations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=1831&ko_name=%EC%B1%84%EB%8F%99%ED%98%B8&paper_id=&key_name=%EC%B1%84%EB%8F%99%ED%98%B8&key_locale=in(Chae, Dongho) 2012-11-29 KAIST Discrete Math Seminar - Choosability with separation in graphs and hypergraphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5024&ko_name=Mohit+Kumbhat&paper_id=&key_pos=%EC%84%B1%EA%B7%A0%EA%B4%80%EB%8C%80%ED%95%99%EA%B5%90&key_locale=in(Mohit Kumbhat) 2012-11-22 2012 KIAS International Conference on Coding Theory and Applications - Harmonic distributions for equitable partitions of a hypercube http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5117&ko_name=%ED%98%84%EC%A2%85%EC%9C%A4&paper_id=&key_name=%ED%98%84%EC%A2%85%EC%9C%A4&key_locale=in(Hyun, Jongyoon) 2012-11-17 2012 KIAS International Conference on Coding Theory and Applications - On the weight enumerators of the projections of the 2-adic Golay code of length 24 to Z2e http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4603&ko_name=%ED%95%9C%EC%84%B1%ED%9C%B4&paper_id=&key_name=%ED%95%9C%EC%84%B1%ED%9C%B4&key_locale=in(Han, Sunghyu) 2012-11-17 2012 KIAS International Conference on Coding Theory and Applications - On the Generalized Spectrum of Linear Codes Associated to Grassmann Varieties and Schubert Varieties http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5116&ko_name=Arunkumar+R.+Patil&paper_id=(Arunkumar R. Patil) 2012-11-17 2012 KIAS International Conference on Coding Theory and Applications - Delta sets for divisors supported in two points (Park, Seungkook) 2012-11-16 2012 KIAS International Conference on Coding Theory and Applications - On the (29; 5)-arcs in PG(2; 7) and linear codes (Cheon, Eunju) 2012-11-16 2012 KIAS International Conference on Coding Theory and Applications - On calculation of the interweight distribution of an equitable partition http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4886&ko_name=Denis+Krotov&paper_id=(Denis Krotov) 2012-11-16 2012 KIAS International Conference on Coding Theory and Applications - On lifted codes and p-adic codes - their weight enumerators http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=571&ko_name=%EB%B0%95%EC%98%81%ED%98%B8&paper_id=&key_name=%EB%B0%95%EC%98%81%ED%98%B8&key_locale=in(Park, Youngho) 2012-11-16 2012 KIAS International Conference on Coding Theory and Applications - Quantum Codes from Classical Codes: An overview http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4877&ko_name=Markus+Grassl&paper_id=(Markus Grassl) 2012-11-16 2012 KIAS International Conference on Coding Theory and Applications - Structures and lower bounds for binary covering arrays (Choi. Soohak) 2012-11-16 2012 KIAS International Conference on Coding Theory and Applications - Some remarks on optimal codes http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=343&ko_name=%EA%B9%80%ED%98%84%EA%B4%91&paper_id=&key_name=%EA%B9%80%ED%98%84%EA%B4%91&key_locale=in(Kim, Hyunkwang) 2012-11-16 2012 KIAS International Conference on Coding Theory and Applications - Highly Nonlinear Boolean Functions with Optimal Algebraic Immunity http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4872&ko_name=Claude+Carlet&paper_id=(Claude Carlet) 2012-11-16 2012 KIAS International Conference on Coding Theory and Applications - History and recent results on the design of M-ary sequence families using Sidelnikov sequences (Song, hongyeop) 2012-11-15 2012 KAIST Mathh Colloquium - GIT and birational geometry of moduli space of curves http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3951&ko_name=%EC%9D%B4%EC%9A%A9%EB%82%A8&paper_id=&key_name=%EC%9D%B4%EC%9A%A9%EB%82%A8&key_locale=in(Lee, Yongnam) 2012-11-15 2012 KIAS International Conference on Coding Theory and Applications - Counting mathods and upper bounds on sizes of codes (Phan Thanh Toan) 2012-11-15 2012 KIAS International Conference on Coding Theory and Applications - Matrix Product Codes over Finite Commutative Rings (Hongwei Liu) 2012-11-15 2012 KIAS International Conference on Coding Theory and Applications - A superclass self-dual codes and bijective S-boxes http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4887&ko_name=Patrick+Sole&paper_id=(Patrick Sole) 2012-11-15 2012 KIAS International Conference on Coding Theory and Applications - Construction of self-dual codes with an automorphism (Kim, hyunjin) 2012-11-15 2012 KIAS International Conference on Coding Theory and Applications - Qudit Communication Network (Kim, Jaewan) 2012-11-15 2012 KIAS International Conference on Coding Theory and Applications - The Feng-Rao bounds (Olav Geil) 2012-11-15 LaTeXWorkshop/2012 - (Cho, Insung) 2012-11-10 LaTeXWorkshop/2012 - Prezi (Lee, Juho) 2012-11-10 LaTeXWorkshop/2012 - , , (Kim, Kangsoo) 2012-11-10 LaTeXWorkshop/2012 - Beamer (Yi, Hoze) 2012-11-10 LaTeXWorkshop/2012 - Beamer (Lee, Kihwang) 2012-11-10 LaTeXWorkshop/2012 - (Kim, Kangsoo) 2012-11-10 KAIST Discrete Math Seminar - Graph Partitions http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4874&ko_name=Gary+MacGillivray&paper_id=(Gary MacGillivray) 2012-11-09 - Antarctic blue ice areas : Their topographic properties and their role as a mass balance indicator ( ) 2012-11-09 ASARC Seminar - On partially ample divisors (Choi, Sungrak) 2012-11-07 The 16th International Workshop on Differential Geometry - Polaractionsoncomplexspaceforms http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4876&ko_name=Jos%C3%A9+Carlos+D%C3%ADaz+Ram&paper_id=(Jose Carlos Díaz-Ramos) 2012-11-03 The 16th International Workshop on Differential Geometry - Transverse Killing forms on a foliated Riemannian manifold. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=1655&ko_name=%EC%A0%95%EC%8A%B9%EB%8B%AC&paper_id=&key_name=%EC%A0%95%EC%8A%B9%EB%8B%AC&key_locale=in(Jung, Seungdal) 2012-11-03 The 16th International Workshop on Differential Geometry - Geometric inequalities for submanifolds with bounded mean curvature http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3948&ko_name=%EC%84%9C%EA%B2%80%EA%B5%90&paper_id=&key_name=%EC%84%9C%EA%B2%80%EA%B5%90&key_locale=in(Seo, Keomkyo) 2012-11-03 The 16th International Workshop on Differential Geometry - Riemannian submanifolds shaped by the bending energy and its allies. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4875&ko_name=%C3%93scar+Jesus+Garay&paper_id=(Óscar Jesus Garay) 2012-11-03 The 16th International Workshop on Differential Geometry - Real hypersurfaces in the complex quadric http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4380&ko_name=Jurgen+Berndt&paper_id=(Jürgen Berndt) 2012-11-03 The 16th International Workshop on Differential Geometry - Capillary surfaces in 3-dimensional homogeneous spaces. (Park, Sungho) 2012-11-03 The 16th International Workshop on Differential Geometry - Riemannian submersion and the eigenforms of the Witten Laplacian. (Kang, Hyunsuk) 2012-11-03 The 16th International Workshop on Differential Geometry - Exotic smooth structures on 4-manifolds. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=612&ko_name=%EB%B0%95%EC%A2%85%EC%9D%BC&paper_id=&key_name=%EB%B0%95%EC%A2%85%EC%9D%BC&key_locale=in(Park, Jongil) 2012-11-02 The 16th International Workshop on Differential Geometry - Isoparametric hypersurfaces and moment map. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4873&ko_name=Reiko+Miyaoka&paper_id=(Reiko Miyaoka) 2012-11-02 - Mesozoic mineral deposit system in South Korea - 1 ( ) 2012-11-02 - Mesozoic mineral deposit system in South Korea - 2 ( ) 2012-11-02 The 16th International Workshop on Differential Geometry - Ruled minimal surfaces in three dimensional homogeneous manifold http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2182&ko_name=%EA%B3%A0%EC%84%B1%EC%9D%80&paper_id=&key_name=%EA%B3%A0%EC%84%B1%EC%9D%80&key_locale=in(Koh, Sungeun) 2012-11-01 2012 KAIST Mathh Colloquium - Limits of Structures and Sparse-Dense Dichotomy http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4831&ko_name=Jaroslav+Nesetril&paper_id=(Jaroslav Nešetřil) 2012-11-01 The 16th International Workshop on Differential Geometry - Real hypersurfaces with vanishing Hopf curvature in non-flat complexspaceform (Makoto Kimura) 2012-11-01 The 16th International Workshop on Differential Geometry - Certain compact homogeneous Lagrangian submanifolds in Hermitian symmetric space. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4502&ko_name=Yoshihiro+Ohnita&paper_id=(Yoshihiro Ohnita) 2012-11-01 The 16th International Workshop on Differential Geometry - Quantum type cohomologies on almost contact metric manifold http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=1762&ko_name=%EC%A1%B0%EC%9A%A9%EC%8A%B9&paper_id=&key_name=%EC%A1%B0%EC%9A%A9%EC%8A%B9&key_locale=in(Cho. Yongseung) 2012-11-01 The 16th International Workshop on Differential Geometry - The intersection of two real forms in Hermitian symmetric spaces of compact type. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4648&ko_name=Makiko+Sumi+Tanaka&paper_id=(Makiko Sumi Tanaka) 2012-11-01 The 16th International Workshop on Differential Geometry - On algebraic integral geometric in equalities. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4762&ko_name=Jiazu+Zhou&paper_id=(Jiazu Zhou) 2012-11-01 The 16th International Workshop on Differential Geometry - Antipodal structure of the intersection of real forms in acomplex flag manifold. (Takashi Sakai) 2012-11-01 ASARC Seminar - Somekawa K-groups, additvie higher Chow groups and class field theory http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4722&ko_name=Toshiro+Hiranouchi&paper_id=(Toshiro Hiranouchi) 2012-10-30 KMRS Seminar - The Mathematics behind Bar Codes http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2588&ko_name=Fadil+Santosa&paper_id=Fadil(Fadil Santosa) 2012-10-29 L-functions and Arithmetic - p-adic representations and p-adic Hodge theory 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4839&ko_name=Seidai+Yasuda&paper_id=(Seidai Yasuda) 2012-10-26 L-functions and Arithmetic - Rational torsion points of abelian varieties and t-modules over a large extension of a local field 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4562&ko_name=Yuichiro+Taguchi&paper_id=(Yuichiro Taguchi) 2012-10-26 L-functions and Arithmetic - A conjecture relating cup products and modular symbols http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4838&ko_name=Romyar+Sharifi&paper_id=(Romyar Sharifi) 2012-10-26 L-functions and Arithmetic - Factorization of p-adic Rankin L-series http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3549&ko_name=Samit+Dasgupta&paper_id=Samit+Dasgupta(Samit Dasgupta) 2012-10-26 L-functions and Arithmetic - Cyclotomic units and p-adic L-functions I and II. (Takae Tsuji) 2012-10-26 L-functions and Arithmetic - Local Epsilon Constants 3 (Mahesh Kakde) 2012-10-25 L-functions and Arithmetic - Cyclotomic units and p-adic L-functions I and II. (Takae Tsuji) 2012-10-25 L-functions and Arithmetic - On Greenberg's conjecture 3 (Thong Nguyen Quang Do) 2012-10-25 KMRS Seminar - Euler equations and the Isometric Embedding Problem II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4317&ko_name=Marshall+Slemrod&paper_id=&key_name=slemrod&key_locale=in(Marshall Slemrod) 2012-10-25 L-functions and Arithmetic - Rational torsion points of abelian varieties and t-modules over a large extension of a local field 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4562&ko_name=Yuichiro+Taguchi&paper_id=(Yuichiro Taguchi) 2012-10-25 L-functions and Arithmetic - Cyclotomic units and p-adic L-functions I and II. (Takae Tsuji) 2012-10-24 L-functions and Arithmetic - On Greenberg's conjecture 2 (Thong Nguyen Quang Do) 2012-10-24 L-functions and Arithmetic - p-adic representations and p-adic Hodge theory 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4839&ko_name=Seidai+Yasuda&paper_id=(Seidai Yasuda) 2012-10-23 L-functions and Arithmetic - Trivial zeroes of p-adic L-functions http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3549&ko_name=Samit+Dasgupta&paper_id=Samit+Dasgupta(Samit Dasgupta) 2012-10-23 L-functions and Arithmetic - Rational torsion points of abelian varieties and t-modules over a large extension of a local field 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4562&ko_name=Yuichiro+Taguchi&paper_id=(Yuichiro Taguchi) 2012-10-23 L-functions and Arithmetic - Local Epsilon Constants 2 (Mahesh Kakde) 2012-10-23 KMRS Seminar - Euler equations and the Isometric Embedding Problem I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4317&ko_name=Marshall+Slemrod&paper_id=&key_name=slemrod&key_locale=in(Marshall Slemrod) 2012-10-23 L-functions and Arithmetic - Homology and cohomology of modular curves http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4838&ko_name=Romyar+Sharifi&paper_id=(Romyar Sharifi) 2012-10-23 L-functions and Arithmetic - On Greenberg's conjecture 1 (Thong Nguyen Quang Do) 2012-10-22 L-functions and Arithmetic - p-adic representations and p-adic Hodge theory 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4839&ko_name=Seidai+Yasuda&paper_id=(Seidai Yasuda) 2012-10-22 L-functions and Arithmetic - Introduction to special values of L-functions: The Dirichlet class number formula and Stark's conjectures http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3549&ko_name=Samit+Dasgupta&paper_id=Samit+Dasgupta(Samit Dasgupta) 2012-10-22 L-functions and Arithmetic - Galois cohomology with restricted ramification http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4838&ko_name=Romyar+Sharifi&paper_id=(Romyar Sharifi) 2012-10-22 L-functions and Arithmetic - Local Epsilon Constants 1 (Mahesh Kakde) 2012-10-22 - Biochemical activities affecting mobility of radionuclide contaminants in fluvial subsurface environment - 1 ( ) 2012-10-19 - Biochemical activities affecting mobility of radionuclide contaminants in fluvial subsurface environment - 2 ( ) 2012-10-19 ASARC Seminar - On the Fundamental Group of Some Genus-2 Fibrations (Sagar Kolte) 2012-10-16 KMRS Seminar - From Boltzmann to Euler: Hilbert's 6th Problem re visited III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4317&ko_name=Marshall+Slemrod&paper_id=&key_name=slemrod&key_locale=in(Marshall Slemrod) 2012-10-16 KAIST - Fake projective planes, II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4473&ko_name=Igor+V.+Dolgachev&paper_id=(Igor Dolgachev) 2012-10-12 - ( ) 2012-10-12 KAIST - Fake projective planes, I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4473&ko_name=Igor+V.+Dolgachev&paper_id=(Igor Dolgachev) 2012-10-11 KAIST Discrete Math Seminar - Irrelevant vertices for the planar Disjoint Paths Problem (Philipp Klaus Krause) 2012-10-11 KMRS Seminar - From Boltzmann to Euler: Hilbert's 6th Problem re visited II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4317&ko_name=Marshall+Slemrod&paper_id=&key_name=slemrod&key_locale=in(Marshall Slemrod) 2012-10-11 KMRS Seminar - From Boltzmann to Euler: Hilbert's 6th Problem re visited I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4317&ko_name=Marshall+Slemrod&paper_id=&key_name=slemrod&key_locale=in(Marshall Slemrod) 2012-10-09 2012 - Simply connected symplectic 4-manifolds with $b_{2}^{+}=1$ and $c_{1}^{2}=2$ - Before and After 2004 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=612&ko_name=%EB%B0%95%EC%A2%85%EC%9D%BC&paper_id=&key_name=%EB%B0%95%EC%A2%85%EC%9D%BC&key_locale=in(Park, Jongil) 2012-10-05 KAIST - Finite Element Approximation of Eigenvalue Problems 4 (Sim, Imbo) 2012-10-05 2012 - $\mathbb Q$-Gorenstein deformation theory and its applications http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3951&ko_name=%EC%9D%B4%EC%9A%A9%EB%82%A8&paper_id=&key_name=%EC%9D%B4%EC%9A%A9%EB%82%A8&key_locale=in(Lee, Yongnam) 2012-10-05 KAIST - Finite Element Approximation of Eigenvalue Problems 3 (Sim, Imbo) 2012-10-05 2012 - (Kim, Gangsoo) 2012-10-05 2012 - (Ahn, Junghyo) 2012-10-05 2012 - Internet Mathematics Videos in Japan (Nobuyuki Tose) 2012-10-05 2012 - The E-Journals and E-publications in Korea and Japan (Takao Namiki) 2012-10-05 2012 - The E-Journals and E-publications in Korea and Japan http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2345&ko_name=%EC%A1%B0%EC%A7%84%ED%99%98&paper_id=&key_name=%EC%A1%B0%EC%A7%84%ED%99%98&key_locale=in(Cho, Jinhwan) 2012-10-05 2012 - Journal of the Mathematical Society of Japan (Yoshio Tsutsumi) 2012-10-05 2012 - The Efforts of Journal of the KMS and Journal of the MSJ http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=1977&ko_name=%ED%95%9C%EC%83%81%EA%B7%BC&paper_id=&key_name=%ED%95%9C%EC%83%81%EA%B7%BC&key_locale=in(Hahn, Sanggeun) 2012-10-05 KAIST - Finite Element Approximation of Eigenvalue Problems 2 (Sim, Imbo) 2012-10-04 KAIST - Finite Element Approximation of Eigenvalue Problems 1 (Sim, Imbo) 2012-10-04 KMRS Seminar - Mapping Class Groups III (Thomas Koberda) 2012-10-02 - Mechanistic understanding of metal sequestration by biogenic Mn oxide : A computational mineralogy study ( ) 2012-09-28 KMRS Seminar - Mapping Class Groups II (Thomas Koberda) 2012-09-27 ASARC Seminar - Descent theorems in motivic homotopy theory and applications http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4295&ko_name=%EB%B0%95%EC%A7%84%ED%98%84&paper_id=&key_name=%EB%B0%95%EC%A7%84%ED%98%84&key_locale=in(Park, Jinhyun) 2012-09-25 KMRS Seminar - Mapping Class Groups I (Thomas Koberda) 2012-09-25 KAIST Discrete Math Seminar - On the Erdős-Szekeres Problem http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4281&ko_name=Andreas+Holmsen&paper_id=&key_name=andreas&key_locale=in(Andreas Holmsen) 2012-09-21 - - 1 ( ) 2012-09-21 - - 2 ( ) 2012-09-21 2012 KAIST Mathh Colloquium - Torsion in Chow groups of projective homogeneous varieties http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4820&ko_name=%EB%B0%B1%EC%83%81%ED%9B%88&paper_id=&key_name=%EB%B0%B1%EC%83%81%ED%9B%88&key_locale=in(Baek, Sanghoon) 2012-09-20 [ ] KAIST - The Virtual Haken Conjecture III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4826&ko_name=Ian+Agol&paper_id=(Ian Agol) 2012-09-07 [ ] KAIST - The Virtual Haken Conjecture II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4826&ko_name=Ian+Agol&paper_id=(Ian Agol) 2012-09-07 [ ] KAIST - The Virtual Haken Conjecture I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4826&ko_name=Ian+Agol&paper_id=(Ian Agol) 2012-09-06 [ ] KAIST - An invitation to cube complexes http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4058&ko_name=%EA%B9%80%EC%83%81%ED%98%84&paper_id=&key_name=%EA%B9%80%EC%83%81%ED%98%84&key_locale=in(Kim, Sanghyun) 2012-09-05 2012 KAIST Mathh Colloquium - Mathematics : why are they needed? http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4829&ko_name=Pierre-Louis+Lions&paper_id=(Pierre-Louis Lions) 2012-09-05 KMRS Seminar - Introduction to hyperbolic orbifolds and knot commensurability III (Genevieve Walsh) 2012-08-28 KMRS Seminar - Mathematical Methods for Imaging 7 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4821&ko_name=Habib+Ammari&paper_id=(Habib Ammari) 2012-08-24 KMRS Seminar - Introduction to hyperbolic orbifolds and knot commensurability II (Genevieve Walsh) 2012-08-23 KMRS Seminar - Mathematical Methods for Imaging 6 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4821&ko_name=Habib+Ammari&paper_id=(Habib Ammari) 2012-08-23 KMRS Seminar - Mathematical Methods for Imaging 5 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4821&ko_name=Habib+Ammari&paper_id=(Habib Ammari) 2012-08-23 KMRS Seminar - Introduction to hyperbolic orbifolds and knot commensurability I (Genevieve Walsh) 2012-08-21 KMRS Seminar - Mathematical Methods for Imaging 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4821&ko_name=Habib+Ammari&paper_id=(Habib Ammari) 2012-08-21 KMRS Seminar - Mathematical Methods for Imaging 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4821&ko_name=Habib+Ammari&paper_id=(Habib Ammari) 2012-08-21 KMRS Seminar - Mathematical Methods for Imaging 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4821&ko_name=Habib+Ammari&paper_id=(Habib Ammari) 2012-08-20 KMRS Seminar - Mathematical Methods for Imaging 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4821&ko_name=Habib+Ammari&paper_id=(Habib Ammari) 2012-08-20 The 10th KAIST Geometric Topology Fair - Minimal genus surfaces in 4-manifolds with a free circle action http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4825&ko_name=Stefan+Friedl&paper_id=(Stefan Friedl) 2012-08-16 Knots and Spatial Graphs 2012 - Arc index of pretzel knots of type (-p, q, r) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1818&ko_name=%EC%A7%84%EA%B5%90%ED%83%9D&paper_id=&key_name=%EC%A7%84%EA%B5%90%ED%83%9D&key_locale=in(Jin, Gyotaek) 2012-08-16 The 10th KAIST Geometric Topology Fair - Graph products, RACGs and RAAGs III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4822&ko_name=Michael+W.+Davis&paper_id=(Michael Davis) 2012-08-16 Knots and Spatial Graphs 2012 - Recent work on Legendrian graphs (Danielle O'Donnol) 2012-08-16 The 10th KAIST Geometric Topology Fair - 3-manifold groups, covering spaces and LERF III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4404&ko_name=Alan+Reid&paper_id=(Alan Reid) 2012-08-16 Knots and Spatial Graphs 2012 - Site-specific Gordian distances of spatial graphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4525&ko_name=Kouki+Taniyama&paper_id=(Kouki Taniyama) 2012-08-16 The 10th KAIST Geometric Topology Fair - The definability criterion for cocompact convex projective polyhedral reflection groups (Choi, Kanghyun) 2012-08-15 The 10th KAIST Geometric Topology Fair - Real projective deformations of hyperbolic reflection orbifolds (Lee, Gyeseon) 2012-08-15 The 10th KAIST Geometric Topology Fair - Introduction to Kashaev volume conjecture (Cho, Jinseok) 2012-08-15 The 10th KAIST Geometric Topology Fair - Group actions on quasi-trees III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4824&ko_name=Koji+Fujiwara&paper_id=(Koji Fujiwara) 2012-08-15 Knots and Spatial Graphs 2012 - Quadrisecants and geometry of knots (Elizabeth Denne) 2012-08-15 The 10th KAIST Geometric Topology Fair - 3-manifold groups, covering spaces and LERF II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4404&ko_name=Alan+Reid&paper_id=(Alan Reid) 2012-08-15 Knots and Spatial Graphs 2012 - Y -exchanges and Conway-Gordon type theorems http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4526&ko_name=Ryo+Nikkuni&paper_id=(Ryo Nikkuni) 2012-08-15 The 10th KAIST Geometric Topology Fair - Knot concordance and invariants from derived covers http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3730&ko_name=%EA%B9%80%ED%83%9C%ED%9D%AC&paper_id=&key_name=%EA%B9%80%ED%83%9C%ED%9D%AC&key_locale=in(Kim, Taehee) 2012-08-14 Knots and Spatial Graphs 2012 - Everywhere equivalent and everywhere different knot diagrams http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4618&ko_name=Stoimenow%2C+Alexander&paper_id=&key_name=Stoimenow&key_locale=in(Alexander Stoimenow) 2012-08-14 The 10th KAIST Geometric Topology Fair - Invariants preserved by mutation (Thilo Kuessner) 2012-08-14 Knots and Spatial Graphs 2012 - Upper bound on lattice stick number of knots (No, Sungjong) 2012-08-14 The 10th KAIST Geometric Topology Fair - Braid group of type (de,e,r) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4330&ko_name=%EC%9D%B4%EC%83%81%EC%A7%84&paper_id=&key_name=%EC%9D%B4%EC%83%81%EC%A7%84&key_locale=in(Lee, Sangjin) 2012-08-14 The 10th KAIST Geometric Topology Fair - Group actions on quasi-trees II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4824&ko_name=Koji+Fujiwara&paper_id=(Koji Fujiwara) 2012-08-14 Knots and Spatial Graphs 2012 - Quadrisecants of knots and links (Elizabeth Denne) 2012-08-14 The 10th KAIST Geometric Topology Fair - Graph products, RACGs and RAAGs II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4822&ko_name=Michael+W.+Davis&paper_id=(Michael Davis) 2012-08-14 Knots and Spatial Graphs 2012 - Mapping a knot by a continuous map http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4525&ko_name=Kouki+Taniyama&paper_id=(Kouki Taniyama) 2012-08-14 The 10th KAIST Geometric Topology Fair - Ford circles and Farey maps for function field http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4582&ko_name=%EC%9E%84%EC%84%A0%ED%9D%AC&paper_id=&key_name=%EC%9E%84%EC%84%A0%ED%9D%AC&key_locale=in(Lim, Seonhee) 2012-08-13 ASARC Seminar - A reverse engineering technique on smooth 4-manifolds III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=612&ko_name=%EB%B0%95%EC%A2%85%EC%9D%BC&paper_id=&key_name=%EB%B0%95%EC%A2%85%EC%9D%BC&key_locale=in(Park, Jongil) 2012-08-13 The 10th KAIST Geometric Topology Fair - Actions of isomorphism groups of Heegaard splittings on projective lamination spaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4409&ko_name=kenichi+Ohshika&paper_id=(Kenichi Ohshika) 2012-08-13 The 10th KAIST Geometric Topology Fair - 3-manifold groups, covering spaces and LERF I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4404&ko_name=Alan+Reid&paper_id=(Alan Reid) 2012-08-13 The 10th KAIST Geometric Topology Fair - Group actions on quasi-trees I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4824&ko_name=Koji+Fujiwara&paper_id=(Koji Fujiwara) 2012-08-13 The 10th KAIST Geometric Topology Fair - Graph products, RACGs and RAAGs I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4822&ko_name=Michael+W.+Davis&paper_id=(Michael Davis) 2012-08-13 KMRS Seminar - Computational Image Processing Series Lectures 5 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4819&ko_name=Xue-Cheng+Tai&paper_id=(Xue-Cheng Tai) 2012-08-09 KAIST Discrete Math Seminar - The down operator and expansions of near rectangular k-Schur functions http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4823&ko_name=Luis+Serrano&paper_id=(Luis Serrano) 2012-08-07 ASARC Seminar - A reverse engineering technique on smooth 4-manifolds II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=612&ko_name=%EB%B0%95%EC%A2%85%EC%9D%BC&paper_id=&key_name=%EB%B0%95%EC%A2%85%EC%9D%BC&key_locale=in(Park, Jongil) 2012-08-07 KMRS Seminar - Computational Image Processing Series Lectures 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4819&ko_name=Xue-Cheng+Tai&paper_id=(Xue-Cheng Tai) 2012-08-07 ASARC Seminar - A reverse engineering technique on smooth 4-manifolds I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=612&ko_name=%EB%B0%95%EC%A2%85%EC%9D%BC&paper_id=&key_name=%EB%B0%95%EC%A2%85%EC%9D%BC&key_locale=in(Park, Jongil) 2012-08-06 KMRS Seminar - Computational Image Processing Series Lectures 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4819&ko_name=Xue-Cheng+Tai&paper_id=(Xue-Cheng Tai) 2012-08-06 ASARC Seminar - Survey on points in a complete intersection III (Woo, Youngho) 2012-08-04 ASARC Seminar - Survey on points in a complete intersection II (Woo, Youngho) 2012-08-02 ASARC Seminar - Survey on points in a complete intersection I (Woo, Youngho) 2012-08-02 KMRS Seminar - Computational Image Processing Series Lectures 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4819&ko_name=Xue-Cheng+Tai&paper_id=(Xue-Cheng Tai) 2012-07-31 KMRS Seminar - Computational Image Processing Series Lectures 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4819&ko_name=Xue-Cheng+Tai&paper_id=(Xue-Cheng Tai) 2012-07-30 KAIST Discrete Math Seminar - Proofs of Two Conjectures of Kenyon and Wilson on Dyck Tilings (Kim, Jangsoo) 2012-07-27 ASARC Seminar - Approximate Converse theorem (Min Lee) 2012-07-12 NIMS Summer School on 2012 - (SAGE) 2 (Lee, Eunjung) 2012-07-07 NIMS Summer School on 2012 - (SAGE) 1 (Lee, Eunjung) 2012-07-06 NIMS Summer School on 2012 - 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1842&ko_name=%EC%B2%9C%EC%A0%95%ED%9D%AC&paper_id=&key_name=%EC%B2%9C%EC%A0%95%ED%9D%AC&key_locale=in(Cheon, Junghee) 201207-06 NIMS Summer School on 2012 - 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1842&ko_name=%EC%B2%9C%EC%A0%95%ED%9D%AC&paper_id=&key_name=%EC%B2%9C%EC%A0%95%ED%9D%AC&key_locale=in(Cheon, Junghee) 201207-06 NIMS Summer School on 2012 - 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1469&ko_name=%EC%9D%B4%ED%96%A5%EC%88%99&paper_id=&key_name=%EC%9D%B4%ED%96%A5%EC%88%99&key_locale=in(Lee, Hyangsook) 2012-07-06 NIMS Summer School on 2012 - 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1469&ko_name=%EC%9D%B4%ED%96%A5%EC%88%99&paper_id=&key_name=%EC%9D%B4%ED%96%A5%EC%88%99&key_locale=in(Lee, Hyangsook) 2012-07-06 NIMS Summer School on 2012 - 2 (Yun, Aaram) 2012-07-05 NIMS Summer School on 2012 - 2 (Lee, Jooyoung) 2012-07-05 NIMS Summer School on 2012 - 1 (Lee, Jooyoung) 2012-07-05 NIMS Summer School on 2012 - 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1977&ko_name=%ED%95%9C%EC%83%81%EA%B7%BC&paper_id=&key_name=%ED%95%9C%EC%83%81%EA%B7%BC&key_locale=in(Hahn, Sanggeun) 2012-07-05 NIMS Summer School on 2012 - 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1977&ko_name=%ED%95%9C%EC%83%81%EA%B7%BC&paper_id=&key_name=%ED%95%9C%EC%83%81%EA%B7%BC&key_locale=in(Hahn, Sanggeun) 2012-07-05 NIMS Summer School on 2012 - 1 (Yun, Aaram) 2012-07-04 KAIST Discrete Math Seminar - Self-similarity of graphs (Lee, Choongbum) 2012-07-04 NIMS Summer School on 2012 - 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1358&ko_name=%EC%9D%B4%EC%9D%B8%EC%84%9D&paper_id=&key_name=%EC%9D%B4%EC%9D%B8%EC%84%9D&key_locale=in(Lee, Insok) 2012-07-04 NIMS Summer School on 2012 - 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1358&ko_name=%EC%9D%B4%EC%9D%B8%EC%84%9D&paper_id=&key_name=%EC%9D%B4%EC%9D%B8%EC%84%9D&key_locale=in(Lee, Insok) 2012-07-04 NIMS Summer School on 2012 - 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2&ko_name=%EA%B9%80%EB%AA%85%ED%99%98&paper_id=&key_name=%EA%B9%80%EB%AA%85%ED%99%98&key_locale=in(Kim, Myunghwan) 2012-07-04 NIMS Summer School on 2012 - 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2&ko_name=%EA%B9%80%EB%AA%85%ED%99%98&paper_id=&key_name=%EA%B9%80%EB%AA%85%ED%99%98&key_locale=in(Kim, Myunghwan) 2012-07-04 KIAS Seminar - Around $p_g=0$ stable surfaces (Giancarlo Urzua) 2012-07-02 KIAS Seminar - Flipping surfaces (Giancarlo Urzua) 2012-07-02 Stochastic Partial Differential Equations and the Related Fields. - Numerical methods for stochastic partial differential equations 9 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4803&ko_name=Gy%C3%B6ngy%2C+Istv%C3%A1n&paper_id=(Istvan Gyongy) 2012-06-29 Stochastic Partial Differential Equations and the Related Fields. - General properties of solutions to second order elliptic and parabolic equations and their probabilistic counterparts 9 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4804&ko_name=Mikhail+V.+Safonov&paper_id=(Mikhail Safonov) 2012-06-29 Stochastic Partial Differential Equations and the Related Fields. - The signature of a path, and inversion (Weijun Xu) 2012-06-28 Stochastic Partial Differential Equations and the Related Fields. - General properties of solutions to second order elliptic and parabolic equations and their probabilistic counterparts 8 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4804&ko_name=Mikhail+V.+Safonov&paper_id=(Mikhail Safonov) 2012-06-28 Stochastic Partial Differential Equations and the Related Fields. - Numerical methods for stochastic partial differential equations 8 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4803&ko_name=Gy%C3%B6ngy%2C+Istv%C3%A1n&paper_id=(Istvan Gyongy) 2012-06-28 Stochastic Partial Differential Equations and the Related Fields. - Elements of the theory of SPDEs and their application to filtering problems of partially observable diffusion processes 8 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2566&ko_name=Krylov%2C+Nicolai&paper_id=Nicolai(Nicolai V. Krylov) 2012-06-28 KAIST Discrete Math Seminar - Dynamic coloring and list dynamic coloring of planar graphs (Lee, Sangjune) 2012-06-27 Stochastic Partial Differential Equations and the Related Fields. - On the Sobolev regularity of the stochastic heat equation on a polygonal domain (Felix Lindner) 2012-06-27 Stochastic Partial Differential Equations and the Related Fields. - On the regularity of SPDEs in a scale of Besov spaces connected to non-linear approximation (Petru A. Cioica) 2012-06-27 Stochastic Partial Differential Equations and the Related Fields. - General properties of solutions to second order elliptic and parabolic equations and their probabilistic counterparts 7 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4804&ko_name=Mikhail+V.+Safonov&paper_id=(Mikhail Safonov) 2012-06-27 Stochastic Partial Differential Equations and the Related Fields. - Numerical methods for stochastic partial differential equations 7 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4803&ko_name=Gy%C3%B6ngy%2C+Istv%C3%A1n&paper_id=(Istvan Gyongy) 2012-06-27 Stochastic Partial Differential Equations and the Related Fields. - Elements of the theory of SPDEs and their application to filtering problems of partially observable diffusion processes 7 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2566&ko_name=Krylov%2C+Nicolai&paper_id=Nicolai(Nicolai V. Krylov) 2012-06-27 Stochastic Partial Differential Equations and the Related Fields. - BV functions in a Gelfand triple and the stochastic reflection problem in a covex set http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4809&ko_name=Xiangchan+Zhu&paper_id=(Xianchan Zhu) 2012-06-26 Stochastic Partial Differential Equations and the Related Fields. - A Weighted L_p-theory for parabolic PDEs with BMO coefficients and applications to SPDEs (Kim, Ildoo) 2012-06-26 Stochastic Partial Differential Equations and the Related Fields. - Numerical methods for stochastic partial differential equations 6 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4803&ko_name=Gy%C3%B6ngy%2C+Istv%C3%A1n&paper_id=(Istvan Gyongy) 2012-06-26 Stochastic Partial Differential Equations and the Related Fields. - General properties of solutions to second order elliptic and parabolic equations and their probabilistic counterparts 6 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4804&ko_name=Mikhail+V.+Safonov&paper_id=(Mikhail Safonov) 2012-06-26 Stochastic Partial Differential Equations and the Related Fields. - Elements of the theory of SPDEs and their application to filtering problems of partially observable diffusion processes 6 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2566&ko_name=Krylov%2C+Nicolai&paper_id=Nicolai(Nicolai V. Krylov) 2012-06-26 Stochastic Partial Differential Equations and the Related Fields. - The stochastic quasi-geostrophic equation http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4808&ko_name=Rongchan+Zhu&paper_id=( Rongchan Zhu) 2012-06-25 Stochastic Partial Differential Equations and the Related Fields. - Accelerated spatial approximations for time discretized SPDE (Eric J. Hall) 2012-06-25 Stochastic Partial Differential Equations and the Related Fields. - Numerical methods for stochastic partial differential equations 5 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4803&ko_name=Gy%C3%B6ngy%2C+Istv%C3%A1n&paper_id=(Istvan Gyongy) 2012-06-25 Stochastic Partial Differential Equations and the Related Fields. - General properties of solutions to second order elliptic and parabolic equations and their probabilistic counterparts 5 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4804&ko_name=Mikhail+V.+Safonov&paper_id=(Mikhail Safonov) 2012-06-25 Stochastic Partial Differential Equations and the Related Fields. - Elements of the theory of SPDEs and their application to filtering problems of partially observable diffusion processes 5 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2566&ko_name=Krylov%2C+Nicolai&paper_id=Nicolai(Nicolai V. Krylov) 2012-06-25 Stochastic Partial Differential Equations and the Related Fields. - General properties of solutions to second order elliptic and parabolic equations and their probabilistic counterparts 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4804&ko_name=Mikhail+V.+Safonov&paper_id=(Mikhail Safonov) 2012-06-22 Stochastic Partial Differential Equations and the Related Fields. - Numerical methods for stochastic partial differential equations 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4803&ko_name=Gy%C3%B6ngy%2C+Istv%C3%A1n&paper_id=(Istvan Gyongy) 2012-06-22 Stochastic Partial Differential Equations and the Related Fields. - Introduction to SPDE under global (and local) monotonicity conditions and applications to stochastic porous media equations 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4805&ko_name=Michael+R%C3%B6ckner&paper_id=(Michael Roeckner) 2012-06-21 Stochastic Partial Differential Equations and the Related Fields. - General properties of solutions to second order elliptic and parabolic equations and their probabilistic counterparts 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4804&ko_name=Mikhail+V.+Safonov&paper_id=(Mikhail Safonov) 2012-06-21 Stochastic Partial Differential Equations and the Related Fields. - Introduction to SPDE under global (and local) monotonicity conditions and applications to stochastic porous media equations 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4805&ko_name=Michael+R%C3%B6ckner&paper_id=(Michael Roeckner) 2012-06-21 Stochastic Partial Differential Equations and the Related Fields. - Elements of the theory of SPDEs and their application to filtering problems of partially observable diffusion processes 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2566&ko_name=Krylov%2C+Nicolai&paper_id=Nicolai(Nicolai V. Krylov) 2012-06-21 Stochastic Partial Differential Equations and the Related Fields. - Introduction to SPDE under global (and local) monotonicity conditions and applications to stochastic porous media equations 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4805&ko_name=Michael+R%C3%B6ckner&paper_id=(Michael Roeckner) 2012-06-20 Stochastic Partial Differential Equations and the Related Fields. - Numerical methods for stochastic partial differential equations 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4803&ko_name=Gy%C3%B6ngy%2C+Istv%C3%A1n&paper_id=(Istvan Gyongy) 2012-06-20 Stochastic Partial Differential Equations and the Related Fields. - Introduction to SPDE under global (and local) monotonicity conditions and applications to stochastic porous media equations 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4805&ko_name=Michael+R%C3%B6ckner&paper_id=(Michael Roeckner) 2012-06-20 Stochastic Partial Differential Equations and the Related Fields. - Elements of the theory of SPDEs and their application to filtering problems of partially observable diffusion processes 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2566&ko_name=Krylov%2C+Nicolai&paper_id=Nicolai(Nicolai V. Krylov) 2012-06-20 Applied Harmonic Analysis 2012 - Polynomial approximation to an ideal filter http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4817&ko_name=Charles+A.+Micchelli&paper_id=(Charles Micchelli) 2012-06-20 Applied Harmonic Analysis 2012 - Convergence Rate of Regularized Laplacian Eigenmaps http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4811&ko_name=Dirong+Chen&paper_id=(Di-Rong Chen) 2012-06-19 Stochastic Partial Differential Equations and the Related Fields. - On Weak Approximation of Stochastic Differential Equations with Discontinuous Drift Coefficient (Kazuhiro Yasuda) 2012-06-19 Stochastic Partial Differential Equations and the Related Fields. - On the HJMM equation with Lévy noise http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4813&ko_name=MICHA%C5%82+BARSKI&paper_id=(Michal Barski) 2012-06-19 Applied Harmonic Analysis 2012 - Wiener’s lemma and nonlinear sampling theorem http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4815&ko_name=Qiyu+Sun&paper_id=(Qiyu Sun) 2012-06-19 Stochastic Partial Differential Equations and the Related Fields. - General properties of solutions to second order elliptic and parabolic equations and their probabilistic counterparts 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4804&ko_name=Mikhail+V.+Safonov&paper_id=(Mikhail Safonov) 2012-06-19 Applied Harmonic Analysis 2012 - Extremely local wavelet bases http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4816&ko_name=Amos+Ron&paper_id=(Amos Ron) 2012-06-19 Stochastic Partial Differential Equations and the Related Fields. - Numerical methods for stochastic partial differential equations 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4803&ko_name=Gy%C3%B6ngy%2C+Istv%C3%A1n&paper_id=(Istvan Gyongy) 2012-06-19 Applied Harmonic Analysis 2012 - Compressed Measurements Needed for Noisy Distributed Compressed Sensing (Lee, Heungno) 2012-06-19 Stochastic Partial Differential Equations and the Related Fields. - Elements of the theory of SPDEs and their application to filtering problems of partially observable diffusion processes 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2566&ko_name=Krylov%2C+Nicolai&paper_id=Nicolai(Nicolai V. Krylov) 2012-06-19 Applied Harmonic Analysis 2012 - Kernel-Based Collocation Method for solving 3D Laplace Equation (Benny Hon) 2012-06-19 Applied Harmonic Analysis 2012 - Sampling Expansion of Bandlimitted Signals of Polynomial Growth on the Real Line http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=883&ko_name=%EC%8B%A0%EC%B0%BD%EC%96%B8&paper_id=&key_pos=%EC%84%9C%EA%B0%95%EB%8C%80%ED%95%99%EA%B5%90&key_locale=in(Shin, Changeon) 2012-06-18 Stochastic Partial Differential Equations and the Related Fields. - Chaotic character of stochastic heat equations (Shang-Yuan Shiu) 2012-06-18 Stochastic Partial Differential Equations and the Related Fields. - Random perturbations of moving boundary problems (Kim, Kunwoo) 2012-06-18 Applied Harmonic Analysis 2012 - Sampling scattered data with Bernstein polynomials: stochastic and deterministic error estimates (Wu, Zongmin) 2012-06-18 Stochastic Partial Differential Equations and the Related Fields. - Numerical methods for stochastic partial differential equations 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4803&ko_name=Gy%C3%B6ngy%2C+Istv%C3%A1n&paper_id=(Istvan Gyongy) 2012-06-18 Applied Harmonic Analysis 2012 - Noisy consistent sampling and optimum signal reconstruction (Akira Hirabayashi) 2012-06-18 Stochastic Partial Differential Equations and the Related Fields. - General properties of solutions to second order elliptic and parabolic equations and their probabilistic counterparts 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4804&ko_name=Mikhail+V.+Safonov&paper_id=(Mikhail Safonov) 2012-06-18 Applied Harmonic Analysis 2012 - Linear Expansion of Thresholds: a Tool for Approximating Image Processing Algoritims http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4806&ko_name=Thierry+Blu&paper_id=(Thierry Blu) 2012-06-18 Stochastic Partial Differential Equations and the Related Fields. - Elements of the theory of SPDEs and their application to filtering problems of partially observable diffusion processes 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2566&ko_name=Krylov%2C+Nicolai&paper_id=Nicolai(Nicolai V. Krylov) 2012-06-18 Applied Harmonic Analysis 2012 - Sampling Sparse Signals with Finite Rate of Innovation: Theory and Biomedical Applications (Pina Maziliano) 2012-06-18 ASARC Seminar - Product structure in the cohomology of polyhedral products http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5124&ko_name=Tony+Bahri&paper_id=(Tony Bahri) 2012-06-13 ASARC Seminar - New topological constructions in toric geometry and topology http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5124&ko_name=Tony+Bahri&paper_id=(Tony Bahri) 2012-06-11 KMRS Seminar - PDEs on Geometry 5 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4317&ko_name=Marshall+Slemrod&paper_id=&key_name=slemrod&key_locale=in(Marshall Slemrod) 2012-06-07 KMRS Seminar - PDEs on Geometry 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4317&ko_name=Marshall+Slemrod&paper_id=&key_name=slemrod&key_locale=in(Marshall Slemrod) 2012-06-05 KMRS Seminar - PDEs on Geometry 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4317&ko_name=Marshall+Slemrod&paper_id=&key_name=slemrod&key_locale=in(Marshall Slemrod) 2012-06-04 - LG ( ) 2012-06-01 KMRS Seminar - PDEs on Geometry 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4317&ko_name=Marshall+Slemrod&paper_id=&key_name=slemrod&key_locale=in(Marshall Slemrod) 2012-05-31 2012 - Comparison study of semi-analytical models for IOP retrieval using GOCI (Jee Eun Min) 2012-05-31 2012 - MUMM ( ) 2012-05-31 2012 - (GOCI) / ( ) 2012-05-31 2012 - (GOCI-II) ( ) 2012-05-31 2012 - An Effect of Radioactivity from a Japanese Coastal Region on the Korean Waters with the Passage of Typhoons (Chul Hoon Hong) 2012-05-31 2012 - ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - Temporal and spatial variability of the Yellow Sea Cold Water Mass in the southeastern Yellow Sea, 2009 to 2011 (Kyung Hee Oh) 2012-05-31 2012 - ( ) 2012-05-31 2012 - (FVCOM) (OI) ( ) 2012-05-31 2012 - / ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - 6 ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - GIS ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - Steric ( ) 2012-05-31 2012 - Effect of ENSO on summer salinity variability in the Yellow and East China Seas ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - Relation between open ocean deep convection and Southern Hemisphere westerlies in an intermediate complexity climate model ( ) 2012-05-31 2012 - · ( ) 2012-05-31 2012 - GOCI (green algae bloom) ( ) 2012-05-31 2012 - · ( ) 2012-05-31 2012 - Morphology and molecular phylogeny of a new heterolobosean amoeboid Selenaion koniopes n. gen., n. sp., isolated from the Wieliczka salt mine (Jong Soo Park) 2012-05-31 2012 - ( ) 2012-05-31 2012 - Application of Kompsat-2 image to estimate distribution of seagrass beds at Deukryang Bay, Korea ( ) 2012-05-31 2012 - Response of eelgrass (Zostera marina L.) to ocean acidification during the winter months: a mesocosm study ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - ITRAX Avaatech XRF Core-scanner ( ) 2012-05-31 2012 - 4 - ( ) 2012-05-31 2012 - 2.3 Myr : IODP Expedition 323 Site U1343 ( ) 2012-05-31 2012 - (IODP Expedition 320 Site U1333) ( ) 2012-05-31 2012 - The differentiation from pseudo coral habitat with spectral analysis ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - · ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - Acoustic Doppler Current Profiler ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - Assimilation adn Elimination of Silver Nanoparticles by Leptocheirus plumulosus and Daphnia magna ( ) 2012-05-31 2012 - Fe ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - Organ distribution and subcellular partitioning of Cd and Zn in seven organs of Octopus minor and their trophic transfer to mouse ( ) 2012-05-31 2012 - Toxicity of Ag Nanoparticles to fresh water Amphipod (Hyalella azteca) (Sanjay Kumar Sundaray) 2012-05-31 2012 - Effects of natural suspended matter on toxicity of silver nanoparticles to Daphnia Magna ( ) 2012-05-31 2012 - (CH4) (N2O) ( ) 2012-05-31 2012 - (GOCI) ( ) 2012-05-31 2012 - , HPLC ( ) 2012-05-31 2012 - a : ( ) 2012-05-31 2012 - a ( ) 2012-05-31 2012 - -a ( ) 2012-05-31 2012 - Red mud ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - pH ( ) 2012-05-31 2012 - ( ) ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - - - ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - ( ) 2012-05-31 2012 - Towing Manual ( ) 2012-05-31 2012 - ( ) 2012-05-31 ASARC Seminar - Todd operator of 2d cones, special values of zeta function and polynomial behavior (Lee, Jungyun) 2012-05-30 ASARC Seminar - BC systems and L-functions (Park, Donghoon) 2012-05-30 ASARC Seminar - A proof of a conjecture of Y. Morita (Lee, Donguk) 2012-05-30 KMRS Seminar - PDEs on Geometry 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4317&ko_name=Marshall+Slemrod&paper_id=&key_name=slemrod&key_locale=in(Marshall Slemrod) 2012-05-29 Intensive Lectures on Orbifolds and the McKay Correspondence - Intensive Lectures on Orbifolds and the McKay Correspondence 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2012-05-19 Intensive Lectures on Orbifolds and the McKay Correspondence - Intensive Lectures on Orbifolds and the McKay Correspondence 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2012-05-19 2012 - ( ) 2012-05-18 2012 - ( ) 2012-05-18 2012 - · ( ) 2012-05-18 2012 - ( ) 2012-05-18 2012 - LED ( ) 2012-05-18 2012 - LED ( ) 2012-05-18 2012 - ( ) 2012-05-18 2012 - ( ) 2012-05-18 2012 - (Pennahia argentata) ( ) 2012-05-18 2012 - ( ) 2012-05-18 2012 - ( ) 2012-05-18 2012 - ( ) 2012-05-18 2012 - Rio Doce ( ) 2012-05-18 2012 - ( ) 2012-05-18 - Sulfur and galogen geochemistry in magmatic-hydrothermal ore-formation ( ) 2012-05-18 2012 KAIST Mathh Colloquium - A family of smooth 4-manifolds with the same Seiberg-Witten invariants http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=612&ko_name=%EB%B0%95%EC%A2%85%EC%9D%BC&paper_id=&key_name=%EB%B0%95%EC%A2%85%EC%9D%BC&key_locale=in(Park, Jongil) 2012-05-17 KAIST Discrete Math Seminar - Path Cover Number in 4-regular Graphs and Hamiltonicity in Connected Regular Graphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5123&ko_name=O%2C+Suil&paper_id=(O, Suil) 2012-05-16 Intensive Lectures on Orbifolds and the McKay Correspondence - Intensive Lectures on Orbifolds and the McKay Correspondence 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2012-05-15 Intensive Lectures on Orbifolds and the McKay Correspondence - Intensive Lectures on Orbifolds and the McKay Correspondence 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2012-05-15 - Geo-Modeling & its Appliations ( ) 2012-05-11 - ( ) 2012-05-04 KAIST Discrete Math Seminar - How to find counterfeit coins? An algorithmic version http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4242&ko_name=%EA%B9%80%EC%A0%95%ED%95%9C&paper_id=&key_name=%EA%B9%80%EC%A0%95%ED%95%9C&key_locale=in(Kim, Jeonghan) 2012-05-03 Institute for Basic Science in 2012 - H-principle in symplectic topology http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4794&ko_name=Yakov+Eliashberg&paper_id=(Yakov Eliashberg) 2012-04-27 Institute for Basic Science in 2012 - Floer theory for Lagrangian submanifolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4357&ko_name=Kaoru+Ono&paper_id=(Kaoru Ono) 2012-04-27 EBS < > - EBS < > (Kim, Hyungjoon) 2012-04-27 Institute for Basic Science in 2012 - The dilogarithm in number theory and geometry http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4793&ko_name=Don+Zagier&paper_id=(Don Zagier) 2012-04-27 2012 KAIST Mathh Colloquium - A scissors congruence proof of Heron's formula http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4677&ko_name=J.+Scott+Carter&paper_id=(Scott Carter) 2012-04-26 KAIST Discrete Math Seminar - On connectivity problems in distance-regular and strongly regular graphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4451&ko_name=Koolen%2C+Jacobus+Hend&paper_id=(Jack Koolen) 2012-04-24 Intensive Lectures on Graded Rings and Fano 3-folds - Intensive Lectures on Graded Rings and Fano 3-folds 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2012-04-21 Intensive Lectures on Graded Rings and Fano 3-folds - Intensive Lectures on Graded Rings and Fano 3-folds 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2012-04-21 KAIST Discrete Math Seminar - On-line list colouring of complete multipartite graphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3837&ko_name=%EA%B9%80%EC%84%9D%EC%A7%84&paper_id=&key_name=%EA%B9%80%EC%84%9D%EC%A7%84&key_locale=in(Kim, Seogjin) 2012-04-18 2012 KAIST Mathh Colloquium - PDE based method for medical imaging and harmonic analysis http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=761&ko_name=%EC%84%9C%EC%A7%84%EA%B7%BC&paper_id=&key_name=%EC%84%9C%EC%A7%84%EA%B7%BC&key_locale=in(Seo, Jinkeun) 2012-04-12 - Mechanistic Biogeochemical Model Applications for Everglades Restoration : A Review of Case Studies and Suggestions for Future Modeling Needs ( ) 2012-04-06 2012 KAIST Mathh Colloquium - Analytic and algebraic methods in the minimal model program http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4775&ko_name=%EA%B9%80%EB%8B%A4%EB%85%B8&paper_id=&key_name=%EA%B9%80%EB%8B%A4%EB%85%B8&key_locale=in(Kim, Dano) 2012-04-05 Workshop on Algebraic Surfaces - Horikawa quintic n-folds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2012-03-30 Workshop on Algebraic Surfaces - Theta duality on Jacobians and Pryms http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4772&ko_name=Juan+Carlos+Naranjo&paper_id=(Juan-Carlos Naranjo) 2012-03-30 Workshop on Algebraic Surfaces - On some rational subvarieties of the Coble quartic http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4774&ko_name=%ED%97%88%EC%84%9D%EB%AC%B8&paper_id=&key_name=%ED%97%88%EC%84%9D%EB%AC%B8&key_locale=in(Huh, Sukmoon) 2012-03-30 Workshop on Algebraic Surfaces - A generalization of Severi inequality http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4771&ko_name=Miguel+Barja&paper_id=(Miguel Barja) 2012-03-30 - Improved 3-D models od seismic velocity and density for the island of Hawaii : Implications for Hawaiian volcano-tectonics ( ) 2012-03-30 Workshop on Algebraic Surfaces - The behaviour of curves on irregular surfaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4770&ko_name=Margarida+Mendes+Lop&paper_id=(Margarida Mendes Lopes) 2012-03-29 Workshop on Algebraic Surfaces - A simply connected numerical Campedelli surface with an involution http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=850&ko_name=%EC%8B%A0%EB%8F%99%EC%88%98&paper_id=&key_name=%EC%8B%A0%EB%8F%99%EC%88%98&key_locale=in(Shin, Dongsoo) 2012-03-29 Workshop on Algebraic Surfaces - Brill-Noether loci of divisors on irregular surfaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4769&ko_name=Rita+Pardini&paper_id=(Rita Pardini) 2012-03-29 Workshop on Algebraic Surfaces - The Fano surface of the cubic 3-fold http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4768&ko_name=Gian+Pietro+Pirola&paper_id=(Gian Pietro Pirola) 2012-03-29 Workshop on Algebraic Surfaces - Redundant blow-ups and Mori dream rational surfaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4773&ko_name=%ED%99%A9%EB%8F%99%EC%84%A0&paper_id=&key_name=%ED%99%A9%EB%8F%99%EC%84%A0&key_locale=in(Hwang, Dongseon) 2012-03-28 Workshop on Algebraic Surfaces - Singularities of Z-acyclic normal surfaces of general type http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4767&ko_name=Mariusz+Koras&paper_id=(Mariusz Koras) 2012-03-28 Workshop on Algebraic Surfaces - Cyclic groups of automorphisms of complex K3 surfaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2259&ko_name=%EA%B8%88%EC%A2%85%ED%95%B4&paper_id=&key_name=%EA%B8%88%EC%A2%85%ED%95%B4&key_locale=in(Keum, Jonghae) 2012-03-28 Workshop on Algebraic Surfaces - An a ne Mumford theorem http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4766&ko_name=Rajendra+Vasant+Gurj&paper_id=(Rajendra Gurjar) 2012-03-28 Workshop on Algebraic Surfaces - Some surfaces with pg = q = 2 and Albanese map of degree 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4430&ko_name=Francesco+Polizzi&paper_id=(Francesco Polizzi) 2012-03-27 Workshop on Algebraic Surfaces - Inoue surfaces and Inoue type manifolds, Part II: Inoue surfaces with pg = 0 and K2 = 7 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4765&ko_name=Ingrid+Bauer&paper_id=(Ingrid Bauer) 2012-03-27 Workshop on Algebraic Surfaces - H-versality of Q-Gorenstein deformations and its applications http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3951&ko_name=%EC%9D%B4%EC%9A%A9%EB%82%A8&paper_id=&key_name=%EC%9D%B4%EC%9A%A9%EB%82%A8&key_locale=in(Lee, Yongnam) 2012-03-27 Workshop on Algebraic Surfaces - The best bound of abelian automorphism groups of surfaces of general type http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4764&ko_name=Sheng-Li+Tan&paper_id=(Sheng-Li Tan) 2012-03-27 Workshop on Algebraic Surfaces - Inoue surfaces and Inoue type manifolds, Part I:Weak rigidity and Inoue type manifolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4537&ko_name=Fabrizio+Catanese&paper_id=(Fabrizio Catanese) 2012-03-27 Intesive Lectures on Riemann-Roch - Intesive Lectures on Riemann-Roch 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2012-03-24 Intesive Lectures on Riemann-Roch - Intesive Lectures on Riemann-Roch 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2012-03-24 - Highly reliable and precise K-Ar chronology of Holocene volcanic rocks ( ) 2012-03-23 - Thermal overprinting of accretionary complex by a specific magma in Pacific type orogenic belt (Prof. Tetsumary Itaya) 2012-03-23 2012 KAIST Mathh Colloquium - Noncommutative Geometry : Quantum Space-Time and Diffeomorphism Invariant Geometry http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4607&ko_name=Rapha%C3%ABl+Ponge&paper_id=&key_name=Rapha%C3%ABl+Ponge&key_locale=in(Raphael Ponge) 2012-03-22 Intesive Lectures on Riemann-Roch - Intesive Lectures on Riemann-Roch 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2012-03-20 - Transmissoion Electron Microscopy(TEM) ( ) 2012-03-16 2012 KAIST Mathh Colloquium - A generalization of the Dedekind eta function over Teichmuller spaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3761&ko_name=%EB%B0%95%EC%A7%84%EC%84%B1&paper_id=&key_name=%EB%B0%95%EC%A7%84%EC%84%B1&key_locale=in(Park, Jinsung) 2012-03-15 KAIST Discrete Math Seminar - Intertwining connectivities for matroids (Tony Huynh) 2012-02-29 2012 SNU/KIAS Topology Winter School - Cohomology of Toric Manifolds 5 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5090&ko_name=Tomoo+Matsumura&paper_id=(Tomoo Matsumura) 2012-02-24 2012 SNU/KIAS Topology Winter School - Symplectic Toric Manifolds 5 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4523&ko_name=Eugene+Lerman&paper_id=(Eugene Lerman) 2012-02-24 2012 KAIST Mathh Colloquium - On the stability of filament flows and Schrodinger maps http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4694&ko_name=Robert+L.+Jerrard&paper_id=(Robert L. Jerrard) 2012-02-23 2012 SNU/KIAS Topology Winter School - Cohomology of Toric Manifolds 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5090&ko_name=Tomoo+Matsumura&paper_id=(Tomoo Matsumura) 2012-02-23 2012 SNU/KIAS Topology Winter School - Symplectic Toric Manifolds 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4523&ko_name=Eugene+Lerman&paper_id=(Eugene Lerman) 2012-02-23 2012 SNU/KIAS Topology Winter School - The quantum cohomology of toric orbifold (Chung, Daewoong) 2012-02-22 2012 SNU/KIAS Topology Winter School - Symplectic Toric Manifolds 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4523&ko_name=Eugene+Lerman&paper_id=(Eugene Lerman) 2012-02-22 2012 SNU/KIAS Topology Winter School - Cohomology of Toric Manifolds 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5090&ko_name=Tomoo+Matsumura&paper_id=(Tomoo Matsumura) 2012-02-22 2012 SNU/KIAS Topology Winter School - Exercise in toric geometry http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4232&ko_name=%EC%A1%B0%EC%B2%A0%ED%98%84&paper_id=&key_name=%EC%A1%B0%EC%B2%A0%ED%98%84&key_locale=in(Cho, Cheolhyun) 2012-02-21 2012 SNU/KIAS Topology Winter School - Cohomology of Toric Manifolds 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5090&ko_name=Tomoo+Matsumura&paper_id=(Tomoo Matsumura) 2012-02-21 2012 SNU/KIAS Topology Winter School - Symplectic Toric Manifolds 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4523&ko_name=Eugene+Lerman&paper_id=(Eugene Lerman) 2012-02-21 2012 KAIST Mathh Colloquium - Quantum invariants for braids and geometry http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4693&ko_name=Thomas+Fiedler&paper_id=(Thomas Fiedler) 2012-02-17 [ ] KAIST - New invariants for tangles from quantum cocycles III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4693&ko_name=Thomas+Fiedler&paper_id=(Thomas Fiedler) 2012-02-16 [ ] KAIST - New invariants for tangles from quantum cocycles II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4693&ko_name=Thomas+Fiedler&paper_id=(Thomas Fiedler) 2012-02-15 KAIST Discrete Math Seminar - Convex equipartitions of convex sets http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5120&ko_name=Alfredo+Hubard&paper_id=(Alfredo Hubard) 2012-02-15 [ ] KAIST - New invariants for tangles from quantum cocycles I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4693&ko_name=Thomas+Fiedler&paper_id=(Thomas Fiedler) 2012-02-14 ASARC Seminar - Generic Inner Projections and the Positivity of Double Point Divisors III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4384&ko_name=Atsushi+Noma&paper_id=(Atsushi Noma) 2012-02-11 ASARC Seminar - Generic Inner Projections and the Positivity of Double Point Divisors II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4384&ko_name=Atsushi+Noma&paper_id=(Atsushi Noma) 2012-02-10 ASARC Seminar - Generic Inner Projections and the Positivity of Double Point Divisors I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4384&ko_name=Atsushi+Noma&paper_id=(Atsushi Noma) 2012-02-09 KAIST Discrete Math Seminar - Proving the Lovasz-Plummer Conjecture http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4688&ko_name=Andrew+D.+King&paper_id=(Andrew King) 2012-02-08 Intensive Lectures:A study on smooth 4-manifolds - A knot surgery - Applications http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=612&ko_name=%EB%B0%95%EC%A2%85%EC%9D%BC&paper_id=&key_name=%EB%B0%95%EC%A2%85%EC%9D%BC&key_locale=in(Park, Jongil) 2012-02-08 ASARC Seminar - The gamma filtration on projective homogeneous varieties http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4820&ko_name=%EB%B0%B1%EC%83%81%ED%9B%88&paper_id=&key_name=%EB%B0%B1%EC%83%81%ED%9B%88&key_locale=in(Baek, Sanghoon) 2012-02-07 Intensive Lectures:A study on smooth 4-manifolds - A knot surgery - Sketch of Proof http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=612&ko_name=%EB%B0%95%EC%A2%85%EC%9D%BC&paper_id=&key_name=%EB%B0%95%EC%A2%85%EC%9D%BC&key_locale=in(Park, Jongil) 2012-02-07 ASARC Seminar - Essential dimension of algebraic structures http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4820&ko_name=%EB%B0%B1%EC%83%81%ED%9B%88&paper_id=&key_name=%EB%B0%B1%EC%83%81%ED%9B%88&key_locale=in(Baek, Sanghoon) 201202-06 Intensive Lectures:A study on smooth 4-manifolds - A knot surgery - Statements and basic properties http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=612&ko_name=%EB%B0%95%EC%A2%85%EC%9D%BC&paper_id=&key_name=%EB%B0%95%EC%A2%85%EC%9D%BC&key_locale=in(Park, Jongil) 2012-02-03 ASARC Seminar - Koszul homology, Koszul algebras, and their syzygies IV http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4689&ko_name=Aldo+Conca&paper_id=(Aldo Conca) 2012-02-03 Intensive Lectures:A study on smooth 4-manifolds - A logarithmic transform and fiber-sum surgery http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=612&ko_name=%EB%B0%95%EC%A2%85%EC%9D%BC&paper_id=&key_name=%EB%B0%95%EC%A2%85%EC%9D%BC&key_locale=in(Park, Jongil) 2012-02-02 ASARC Seminar - Koszul homology, Koszul algebras, and their syzygies III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4689&ko_name=Aldo+Conca&paper_id=(Aldo Conca) 2012-02-02 KAIST Discrete Math Seminar - Space Crossing Numbers http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5120&ko_name=Alfredo+Hubard&paper_id=(Alfredo Hubard) 2012-02-01 KAIST Discrete Math Seminar - Lattice paths and Lagrangian matroids http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5121&ko_name=Edward+D.+Kim&paper_id=(Edward D. Kim) 2012-02-01 KAIST Discrete Math Seminar - An analogue of Gromov's waist theorem for coloring the cube http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4690&ko_name=Roman+Karasev&paper_id=(Roman Karasev) 2012-02-01 ASARC Seminar - Kosniowski conjecture and unitary toric manifolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4691&ko_name=Zhi+Lu&paper_id=(Zhi Lu) 2012-02-01 ASARC Seminar - Schubert Calculus http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4692&ko_name=Haibao+Duan&paper_id=(Haibao Duan) 2012-02-01 KAIST Discrete Math Seminar - Universality for families of non-crossing convex sets (Michael Dobbins) 2012-02-01 ASARC Seminar - Schubert Calculus http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4692&ko_name=Haibao+Duan&paper_id=(Haibao Duan) 2012-01-30 ASARC Seminar - Koszul homology, Koszul algebras, and their syzygies II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4689&ko_name=Aldo+Conca&paper_id=(Aldo Conca) 2012-01-26 ASARC Seminar - Koszul homology, Koszul algebras, and their syzygies I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4689&ko_name=Aldo+Conca&paper_id(Aldo Conca) 2012-01-25 Intensive Lectures:A study on smooth 4-manifolds - Seiberg-Witten theory http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=612&ko_name=%EB%B0%95%EC%A2%85%EC%9D%BC&paper_id=&key_name=%EB%B0%95%EC%A2%85%EC%9D%BC&key_locale=in(Park, Jongil) 2012-01-20 Intensive Lectures:A study on smooth 4-manifolds - An overview on 4-manifolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=612&ko_name=%EB%B0%95%EC%A2%85%EC%9D%BC&paper_id=&key_name=%EB%B0%95%EC%A2%85%EC%9D%BC&key_locale=in(Park, Jongil) 2012-01-19 Korea PDE Winter School #2 - Standing waves of the Chern-Simons-Schrodinger equations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4613&ko_name=%ED%97%88%ED%98%95%EC%A7%84&paper_id=&key_name=%ED%97%88%ED%98%95%EC%A7%84&key_locale=in(Huh, Hyungjin) 2012-01-13 Korea PDE Winter School #2 - Mountain Pass Theorem and some topological concepts for the multiplicity results 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3679&ko_name=%EB%B3%80%EC%9E%AC%ED%98%95&paper_id=&key_name=%EB%B3%80%EC%9E%AC%ED%98%95&key_locale=in(Byeon, Jaeyoung) 2012-01-13 Korea PDE Winter School #2 - Mountain Pass Theorem and some topological concepts for the multiplicity results 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3679&ko_name=%EB%B3%80%EC%9E%AC%ED%98%95&paper_id=&key_name=%EB%B3%80%EC%9E%AC%ED%98%95&key_locale=in(Byeon, Jaeyoung) 2012-01-13 Korea PDE Winter School #2 - An invariant elliptic estimate http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4593&ko_name=%EC%A1%B0%EC%9A%A9%EA%B7%BC&paper_id=&key_name=%EC%A1%B0%EC%9A%A9%EA%B7%BC&key_locale=in(Cho, Yonggeun) 2012-01-12 Korea PDE Winter School #2 - Integrability results of nonlinear elliptic obstacle problems http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=730&ko_name=%EB%B3%80%EC%88%9C%EC%8B%9D&paper_id=&key_name=%EB%B3%80%EC%88%9C%EC%8B%9D&key_locale=in(Byun, Sunsig) 2012-01-12 Korea PDE Winter School #2 - Multidimensional screening: an application to economic theory http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3220&ko_name=Robert+J.+McCann&paper_id=McCann(Robert McCann) 2012-01-12 Korea PDE Winter School #2 - Regularity and counterexamples for general costs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3220&ko_name=Robert+J.+McCann&paper_id=McCann(Robert McCann) 2012-01-12 Korea PDE Winter School #2 - Lecture #4: (i) generating eps files for publication: adding legends, titles, ...(ii) making movies and real time demonstration http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5128&ko_name=%EC%A0%95%EC%9E%AC%EC%99%84&paper_id=&key_name=%EC%A0%95%EC%9E%AC%EC%99%84&key_locale=in(Chung, Jaywan) 2012-01-12 Korea PDE Winter School #2 - Lecture #3: (iii) PDE solver pdepe in 1-D (iv) PDE solver in 2-D http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5128&ko_name=%EC%A0%95%EC%9E%AC%EC%99%84&paper_id=&key_name=%EC%A0%95%EC%9E%AC%EC%99%84&key_locale=in(Chung, Jaywan) 2012-01-12 Korea PDE Winter School #2 - Linear Algebra, Eigenvalue problems, Sobolev Imbeddings and Nonlinear Eigenvalue problems 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3679&ko_name=%EB%B3%80%EC%9E%AC%ED%98%95&paper_id=&key_name=%EB%B3%80%EC%9E%AC%ED%98%95&key_locale=in(Byeon, Jaeyoung) 2012-01-11 Korea PDE Winter School #2 - Linear Algebra, Eigenvalue problems, Sobolev Imbeddings and Nonlinear Eigenvalue problems 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3679&ko_name=%EB%B3%80%EC%9E%AC%ED%98%95&paper_id=&key_name=%EB%B3%80%EC%9E%AC%ED%98%95&key_locale=in(Byeon, Jaeyoung) 2012-01-11 Korea PDE Winter School #2 - Navier-Stokes and related problems http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2204&ko_name=%EA%B3%BD%EB%AF%BC%EA%B7%9C&paper_id=&key_name=%EA%B3%BD%EB%AF%BC%EA%B7%9C&key_locale=in(Kwak, Minkyu) 2012-01-10 Korea PDE Winter School #2 - Methods for obtaining regularity of optimal mappings http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3220&ko_name=Robert+J.+McCann&paper_id=McCann(Robert McCann) 2012-01-10 Korea PDE Winter School #2 - Existence, uniqueness, and characterization of optimal maps http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3220&ko_name=Robert+J.+McCann&paper_id=McCann(Robert McCann) 2012-01-10 Korea PDE Winter School #2 - Lecture #2: (i) MATLAB for FDM (ii) ODE solver http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5119&ko_name=%EC%A0%95%EC%9E%AC%ED%99%98&paper_id=&key_name=%EC%A0%95%EC%9E%AC%ED%99%98&key_locale=in(Chung, Jaywan) 2012-01-10 Korea PDE Winter School #2 - Lecture #1: (i) Running MATLAB from Window (ii) managing files (iii) 10 Basic MATLAB logics http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5128&ko_name=%EC%A0%95%EC%9E%AC%EC%99%84&paper_id=&key_name=%EC%A0%95%EC%9E%AC%EC%99%84&key_locale=in(Chung, Jaywan) 2012-01-10 Korea PDE Winter School #2 - Overview on Calculus of Variations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3679&ko_name=%EB%B3%80%EC%9E%AC%ED%98%95&paper_id=&key_name=%EB%B3%80%EC%9E%AC%ED%98%95&key_locale=in(Byeon, Jaeyoung) 2012-01-09 Korea PDE Winter School #2 - An introduction to optimal transportation http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3220&ko_name=Robert+J.+McCann&paper_id=McCann(Robert McCann) 2012-01-09 KIAS Intensive Lecture Series on Rigid Geometry and the Local Langlands Correspondence - Intro to LLC and application of rigid geometry to LLC http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4683&ko_name=Teruyoshi+Yoshida&paper_id=(Teruyoshi Yoshida) 2012-01-05 KIAS Intensive Lecture Series on Rigid Geometry and the Local Langlands Correspondence - p-adic uniformization of Shimura varieties and applications http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4681&ko_name=Tetsushi+Ito&paper_id=(Tetsushi Ito) 2012-01-05 KIAS Intensive Lecture Series on Rigid Geometry and the Local Langlands Correspondence - Rigid spaces and their etale cohomology http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4682&ko_name=Yoichi+Mieda&paper_id=(Yoichi Mieda) 2012-01-05 KIAS Intensive Lecture Series on Rigid Geometry and the Local Langlands Correspondence - Intro to LLC and application of rigid geometry to LLC http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4683&ko_name=Teruyoshi+Yoshida&paper_id=(Teruyoshi Yoshida) 2012-01-05 ASARC Seminar - Powers of 2 in modular degrees of modular abelian varieties http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5118&ko_name=Srilakshmi+Krishnamo&paper_id=(Srilakshmi Krishnamoorthy) 2012-01-04 KIAS Intensive Lecture Series on Rigid Geometry and the Local Langlands Correspondence - Rigid spaces and their etale cohomology http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4682&ko_name=Yoichi+Mieda&paper_id=(Yoichi Mieda) 2012-01-04 KIAS Intensive Lecture Series on Rigid Geometry and the Local Langlands Correspondence - Intro to LLC and application of rigid geometry to LLC http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4683&ko_name=Teruyoshi+Yoshida&paper_id=(Teruyoshi Yoshida) 2012-01-04 KIAS Intensive Lecture Series on Rigid Geometry and the Local Langlands Correspondence - Rigid spaces and their etale cohomology http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4682&ko_name=Yoichi+Mieda&paper_id=(Yoichi Mieda) 2012-01-03 KIAS Intensive Lecture Series on Rigid Geometry and the Local Langlands Correspondence - Intro to LLC and application of rigid geometry to LLC http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4684&ko_name=Sug+Woo+Shin&paper_id=(Shin Sugwoo) 2012-01-03 KIAS Intensive Lecture Series on Rigid Geometry and the Local Langlands Correspondence - Rigid spaces and their etale cohomology http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4682&ko_name=Yoichi+Mieda&paper_id=(Yoichi Mieda) 2012-01-02 KIAS Intensive Lecture Series on Rigid Geometry and the Local Langlands Correspondence - Intro to LLC and application of rigid geometry to LLC http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4684&ko_name=Sug+Woo+Shin&paper_id=(Shin Sugwoo) 2012-01-02 - ( ) 2011-12-02 Back to top of page 2011 KAIST Discrete Math Seminar - Avoiding Large Squares in Partial Words http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5096&ko_name=%EC%B5%9C%EC%9D%BC%EA%B7%9C&paper_id=&key_locale=in(Choi, Ilkyoo) 2011-12-22 KAIST Discrete Math Seminar - Quartets in Weakly Compatible Split Systems (Stefan Gruenewald) 2011-12-09 2011 KAIST Math Colloquium - Geometry of the Coble quartic http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4774&ko_name=%ED%97%88%EC%84%9D%EB%AC%B8&paper_id=&key_name=%ED%97%88%EC%84%9D%EB%AC%B8&key_locale=in(Huh, Sukmoon) 2011-12-08 KAIST Discrete Math Seminar - A New Class of Linear Codes for Cryptographic Uses http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4696&ko_name=%EA%B9%80%EC%A2%85%EB%9D%BD&paper_id=&key_name=%EA%B9%80%EC%A2%85%EB%9D%BD&key_locale=in(Kim, Jon-lark) 2011-11-25 2011 KAIST Math Colloquium - Fundamental groups in number theory http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4572&ko_name=%EA%B9%80%EB%AF%BC%ED%98%95&paper_id=&key_name=%EA%B9%80%EB%AF%BC%ED%98%95&key_locale=in(Kim, Minhyong) 2011-11-24 2011 KAIST Math Colloquium - Equivariant cohomology, GKM-compatibility, and Schubert calculus for Hessenberg varieties http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4642&ko_name=Megumi+Harada&paper_id=(Megumi Harada) 2011-11-17 ASARC Seminar - Intensive Lectures series(6)- GKM theory and equivariant Schubert calculus 6 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4642&ko_name=Megumi+Harada&paper_id=(Megumi Harada) 2011-11-16 ASARC Seminar - Volume conjecture and extended Bloch group http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5174&ko_name=%EC%A1%B0%EC%A7%84%EC%84%9D&paper_id=&key_name=%EC%A1%B0%EC%A7%84%EC%84%9D&key_locale=in(Cho, Jinseok) 2011-11-15 ASARC Seminar - Intensive Lectures series(5)- GKM theory and equivariant Schubert calculus 5 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4642&ko_name=Megumi+Harada&paper_id=(Megumi Harada) 2011-11-15 ASARC Seminar - Intensive Lectures series(4)- GKM theory and equivariant Schubert calculus 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4642&ko_name=Megumi+Harada&paper_id=(Megumi Harada) 2011-11-14 ASARC Seminar - Intensive Lectures series(3)- GKM theory and equivariant Schubert calculus 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4642&ko_name=Megumi+Harada&paper_id=(Megumi Harada) 2011-11-11 KAIST Discrete Math Seminar - Approximating Max-Min Wighted T-join http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4643&ko_name=Satoru+Iwata&paper_id=(Satoru Iwata) 2011-11-11 - Continental Construction in Orogenic Belts : Evidence from Accretionary Complexes and Granitoid Magmatism (Dr. Inna Safonova) 2011-11-11 2011 KAIST Math Colloquium - Submodular Optimization and Approximation Algorithms http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4643&ko_name=Satoru+Iwata&paper_id=(Satoru Iwata) 2011-11-10 ASARC Seminar - Intensive Lectures series(2)- GKM theory and equivariant Schubert calculus 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4642&ko_name=Megumi+Harada&paper_id=(Megumi Harada) 2011-11-10 ASARC Seminar - Intensive Lectures series(1)- GKM theory and equivariant Schubert calculus 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4642&ko_name=Megumi+Harada&paper_id=(Megumi Harada) 2011-11-09 ASARC Seminar - Affine embeddings of reductive groups (Hyun, Yoonsuk) 2011-11-08 2011 NIMS Hot Topics Workshop on The 15th International Wokrshop on Differential Geometry - Causal automorphisms on two-dimensional Minkowski space (Kim, Dohyung) 2011-11-05 2011 NIMS Hot Topics Workshop on The 15th International Wokrshop on Differential Geometry - Polar actions on symmetric spaces (II) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4380&ko_name=Jurgen+Berndt&paper_id=(Jurgen Berndt) 2011-11-05 2011 NIMS Hot Topics Workshop on The 15th International Wokrshop on Differential Geometry - Minimal surfaces in $H^\2$ R (Pyo, Jouncheol) 2011-11-05 2011 NIMS Hot Topics Workshop on The 15th International Wokrshop on Differential Geometry - Real hypersurfaces in complex two-plane Grassmannians with -parallel structure Jacobi operator http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=1679&ko_name=%EC%A0%95%EC%9E%84%EC%88%9C&paper_id=&key_name=%EC%A0%95%EC%9E%84%EC%88%9C&key_locale=in(Jeong, Imsoon) 2011-11-05 2011 NIMS Hot Topics Workshop on The 15th International Wokrshop on Differential Geometry - Contact manifolds and the Reeb flow http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=1780&ko_name=%EC%A1%B0%EC%A2%85%ED%83%9D&paper_id=&key_name=%EC%A1%B0%EC%A2%85%ED%83%9D&key_locale=in(Cho, Jongtaek) 2011-11-04 2011 NIMS Hot Topics Workshop on The 15th International Wokrshop on Differential Geometry - Orbit surfaces of the 3-dimensional geometries http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=618&ko_name=%EB%B0%95%EC%A4%80%EC%83%81&paper_id=&key_name=%EB%B0%95%EC%A4%80%EC%83%81&key_locale=in(Park, Joonsang) 2011-11-04 2011 NIMS Hot Topics Workshop on The 15th International Wokrshop on Differential Geometry - Eigenvalue estimates of the basic Dirac operator http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=1655&ko_name=%EC%A0%95%EC%8A%B9%EB%8B%AC&paper_id=&key_name=%EC%A0%95%EC%8A%B9%EB%8B%AC&key_locale=in(Jung, Seoungdal) 2011-11-04 2011 NIMS Hot Topics Workshop on The 15th International Wokrshop on Differential Geometry - Topological properties of symmetric products http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=1762&ko_name=%EC%A1%B0%EC%9A%A9%EC%8A%B9&paper_id=&key_name=%EC%A1%B0%EC%9A%A9%EC%8A%B9&key_locale=in(Cho, Yongseung) 2011-11-04 2011 NIMS Hot Topics Workshop on The 15th International Wokrshop on Differential Geometry - Certain Lagrangian submanifolds in Hermitian symmetric spaces and Hamiltonian stability problems (II) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4502&ko_name=Yoshihiro+Ohnita&paper_id=(Yoshihiro Ohnita) 2011-11-04 2011 NIMS Hot Topics Workshop on The 15th International Wokrshop on Differential Geometry - Antipodal sets of compact Riemannian symmetric spaces and their applications http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4648&ko_name=Makiko+Sumi+Tanaka&paper_id=(Makiko Sumi Tanaka) 2011-11-04 2011 NIMS Hot Topics Workshop on The 15th International Wokrshop on Differential Geometry - The Q-curvature flow in a closed CR 3-manifold http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5175&ko_name=Saotome%2C+Takanari&paper_id=(Takanari Saotome) 2011-11-04 2011 NIMS Hot Topics Workshop on The 15th International Wokrshop on Differential Geometry - On 3-dimensional compact real hypersurfaces of a complex space form http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4378&ko_name=Mayuko+Kon&paper_id=(Mayuko Kon) 2011-11-04 - : ( ) 2011-11-04 2011 NIMS Hot Topics Workshop on The 15th International Wokrshop on Differential Geometry - Boundary problem for the refined analytic torsion on compact manifolds with boundary http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=1335&ko_name=%EC%9D%B4%EC%9C%A4%EC%9B%90&paper_id=&key_name=%EC%9D%B4%EC%9C%A4%EC%9B%90&key_locale=in(Lee, Yoonweon) 2011-11-03 2011 NIMS Hot Topics Workshop on The 15th International Wokrshop on Differential Geometry - Classification of equivariant vector bundles over two-sphere (Kim, Minkyu) 2011-11-03 2011 NIMS Hot Topics Workshop on The 15th International Wokrshop on Differential Geometry - Semi-continuity theorems for holomorphic automorphism groups http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2267&ko_name=%EA%B9%80%EA%B0%95%ED%83%9C&paper_id=&key_name=%EA%B9%80%EA%B0%95%ED%83%9C&key_locale=in(Kim, Kangtae) 2011-11-03 2011 NIMS Hot Topics Workshop on The 15th International Wokrshop on Differential Geometry - Polar actions on symmetric spaces (I) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4380&ko_name=Jurgen+Berndt&paper_id=(Jurgen Berndt) 2011-11-03 2011 NIMS Hot Topics Workshop on The 15th International Wokrshop on Differential Geometry - Certain Lagrangian submanifolds in Hermitian symmetric spaces and Hamiltonian stability problems (I) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4502&ko_name=Yoshihiro+Ohnita&paper_id=(Yoshihiro Ohnita) 2011-11-03 2011 NIMS Hot Topics Workshop on The 15th International Wokrshop on Differential Geometry - Fibred Riemannian spaces with Sasaki-Einstein metric http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=30&ko_name=%EA%B9%80%EB%B3%91%ED%95%99&paper_id=&key_name=%EA%B9%80%EB%B3%91%ED%95%99&key_locale=in(Kim, Byunghak) 2011-11-03 2011 NIMS Hot Topics Workshop on The 15th International Wokrshop on Differential Geometry - On some classes of hypersurfaces in spheres http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4379&ko_name=Guoxin+Wei&paper_id=(Guoxin Wei) 2011-11-03 KAIST Discrete Math Seminar - Algorithms on Tree Decompositions and Time Improvements http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4533&ko_name=Hans+L.Bodlaender&paper_id=(Hans L. Bodlaender) 2011-10-31 5th workshop on Graph Classes, Optimization, and Width Parameters (GROW 2011) - Induced/distance-k matchings and min-max relations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4687&ko_name=R.+Sritharan&paper_id=(R. Sritharan) 2011-10-29 5th workshop on Graph Classes, Optimization, and Width Parameters (GROW 2011) - The Complexity of Register Allocation (Philipp Klaus Krause) 2011-10-29 5th workshop on Graph Classes, Optimization, and Width Parameters (GROW 2011) - Induced paths of given parity in planar graphs in polynomial time http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4645&ko_name=Marcin+Kami%C5%84ski&paper_id=(Marcin Kamiński) 2011-10-29 5th workshop on Graph Classes, Optimization, and Width Parameters (GROW 2011) - On the enumeration of minimal dominating sets and variants http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5178&ko_name=Kant%C3%A9%2C+Mamadou+Moust&paper_id=(Mamadou Moustapha Kante) 2011-10-29 5th workshop on Graph Classes, Optimization, and Width Parameters (GROW 2011) - Finding Contractions and Induced Minors in Chordal Graphs via Disjoint Paths http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5177&ko_name=Belmonte%2C+R%C3%A9my&paper_id=(Remy Belmonte) 2011-10-29 5th workshop on Graph Classes, Optimization, and Width Parameters (GROW 2011) - Digraph minors and a wqo for tournaments http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5176&ko_name=%EA%B9%80%EC%9D%BC%ED%9D%AC&paper_id=&key_name=%EA%B9%80%EC%9D%BC%ED%9D%AC&key_locale=in(Kim, Ilhee) 2011-10-29 5th workshop on Graph Classes, Optimization, and Width Parameters (GROW 2011) - Well-quasi-ordering, clique-width and factorial properties of graphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4637&ko_name=Vadim+Lozin&paper_id=(Vadim Lozin) 2011-10-29 5th workshop on Graph Classes, Optimization, and Width Parameters (GROW 2011) - Hardness Results and an Exact Exponential Algorithm for the Spanning Tree Congestion Problem http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4646&ko_name=Yota+Otachi&paper_id=(Yota Otachi) 2011-10-29 5th workshop on Graph Classes, Optimization, and Width Parameters (GROW 2011) - Graph partitioning and tree-width http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4644&ko_name=Bogdan+Oporowski&paper_id=(Bogdan Oporowski) 2011-10-29 5th workshop on Graph Classes, Optimization, and Width Parameters (GROW 2011) - Partitions of Chordal Graphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4641&ko_name=Pavol+Hell&paper_id=(Pavol Hell) 2011-10-29 5th workshop on Graph Classes, Optimization, and Width Parameters (GROW 2011) - Parameterized domination in circle graphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4647&ko_name=Ignasi+Sau+Valls&paper_id=(Ignasi Sau) 2011-10-29 5th workshop on Graph Classes, Optimization, and Width Parameters (GROW 2011) - Lower Bounds on the Complexity of MSO1 Model-Checking (Jan Obdrzalek) 2011-10-28 5th workshop on Graph Classes, Optimization, and Width Parameters (GROW 2011) - Deciding First Order Logic Properties of Matroids http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4396&ko_name=Daniel+Kral%E2%80%99&paper_id=(Daniel Kral) 2011-10-28 5th workshop on Graph Classes, Optimization, and Width Parameters (GROW 2011) - On the constructive power of monadic second-order logic http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4628&ko_name=Bruno+Courcelle&paper_id=(Bruno Courcelle) 2011-10-28 5th workshop on Graph Classes, Optimization, and Width Parameters (GROW 2011) - Pivot-minors and vertex-minors of trees and paths (O, Joungkwon) 2011-10-28 5th workshop on Graph Classes, Optimization, and Width Parameters (GROW 2011) - Obstructions for linear rankwidth at most 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4629&ko_name=Andrzej+Proskurowski&paper_id=(Andrzej Proskurowski) 2011-10-28 5th workshop on Graph Classes, Optimization, and Width Parameters (GROW 2011) - X-boundedness of graphs with cuts of small rank http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4630&ko_name=Zden%C4%9Bk+Dvo%C5%99%C3%A1k&paper_id=(Zdenek Dvorak) 2011-1028 5th workshop on Graph Classes, Optimization, and Width Parameters (GROW 2011) - Twin-Cover: Beyond Vertex Cover in Parameterized Algorithmics http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5179&ko_name=Ganian%2C+Robert&paper_id=(Robert Ganian) 2011-10-27 2011 KAIST Math Colloquium - Fully computable upper bounds for finite element approximation http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4347&ko_name=%EA%B9%80%EA%B4%91%EC%97%B0&paper_id=&key_name=%EA%B9%80%EA%B4%91%EC%97%B0&key_locale=in(Kim, Kwangyeon) 2011-10-27 5th workshop on Graph Classes, Optimization, and Width Parameters (GROW 2011) - Partitioning Trees with Supply, Demand and Edge-Capacity http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4612&ko_name=Takao+Nishizeki&paper_id=(Takao Nishizeki) 2011-10-27 5th workshop on Graph Classes, Optimization, and Width Parameters (GROW 2011) - Parameterized K4-minor cover in single exponential time http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4611&ko_name=Christophe+Paul&paper_id=(Christophe Paul) 2011-10-27 5th workshop on Graph Classes, Optimization, and Width Parameters (GROW 2011) - Graphs of Truly Sublinear Treewidth http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4535&ko_name=Daniel+Lokshtanov&paper_id=(Daniel Lokshtanov) 2011-10-27 5th workshop on Graph Classes, Optimization, and Width Parameters (GROW 2011) - Linear min-max relation between the treewidth of H-minor-free graphs and its largest grid minor http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4649&ko_name=Yusuke+Kobayashi&paper_id=(Yusuke Kobayashi) 2011-10-27 5th workshop on Graph Classes, Optimization, and Width Parameters (GROW 2011) - Explicit Bounds for Graph Minors (Tony Huynh) 2011-10-27 5th workshop on Graph Classes, Optimization, and Width Parameters (GROW 2011) - Preprocessing and Kernelizing Treewidth http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4533&ko_name=Hans+L.Bodlaender&paper_id=(Hans L. Bodlaender) 2011-10-27 KAIST Discrete Math Seminar - Permutation Statistics on Signed Permutation Groups http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4568&ko_name=Jiang+Zeng&paper_id=(Jiang Zeng) 2011-10-19 KAIST Discrete Math Seminar - On Diameters of Transportation and Network Flow Polytopes http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5121&ko_name=Edward+D.+Kim&paper_id=(Edward D. Kim) 2011-10-14 2011 KAIST Math Colloquium - Rigidity, flexibility and dynamics on character variety http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3987&ko_name=%EA%B9%80%EC%9D%B8%EA%B0%95&paper_id=&key_name=%EA%B9%80%EC%9D%B8%EA%B0%95&key_locale=in(Kim, Inkang) 2011-10-13 KAIST Discrete Math Seminar - Realizability of Antiprisms (Michael Dobbins) 2011-10-07 - Clathrate Compounds and Its Application to Gas Storage ( ) 2011-10-07 Mini-workshop on Commutative Algebra, Combinatorial and Projective Algebraic Geometry - Asymptotic stability of regularity of powers of ideals (N. Trung) 2011-10-01 Mini-workshop on Commutative Algebra, Combinatorial and Projective Algebraic Geometry - On Non-normal del Pezzo varieties http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5180&ko_name=%EC%9D%B4%EC%99%84%EC%84%9D&paper_id=&key_name=%EC%9D%B4%EC%99%84%EC%84%9D&key_locale=in(Lee, Wanseok) 2011-10-01 Mini-workshop on Commutative Algebra, Combinatorial and Projective Algebraic Geometry - Partial regularities of sums and intersections of powers of monomial ideals (T. N. Trung) 2011-10-01 Mini-workshop on Commutative Algebra, Combinatorial and Projective Algebraic Geometry - Bruhat order, Schubert varieties and hyperplane arrangements http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5100&ko_name=%EC%9C%A0%ED%99%98%EC%B2%A0&paper_id=&key_locale=in(Yoo, Hwanchul) 2011-10-01 KAIST Discrete Math Seminar - Phase transitions in random graphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4571&ko_name=Kang%2C+Mihyun&paper_id=(Kang, Mihyun) 2011-09-30 Mini-workshop on Commutative Algebra, Combinatorial and Projective Algebraic Geometry - On the reduction number and related topics (L. Hoa) 2011-09-30 Mini-workshop on Commutative Algebra, Combinatorial and Projective Algebraic Geometry - Remarks on secant spaces of nonspecial line bundles on curves http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=62&ko_name=%EA%B9%80%EC%84%A0%EC%9E%90&paper_id=&key_name=%EA%B9%80%EC%84%A0%EC%9E%90&key_locale=in(Kim, Seonja) 2011-09-30 Mini-workshop on Commutative Algebra, Combinatorial and Projective Algebraic Geometry - Toric variety and Cox ring http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5181&ko_name=Rohrer%2C+Fred+&paper_id=(Fred Rohrer) 2011-09-30 2011 KAIST Math Colloquium - (Park, Seonhee) 2011-09-29 2011 - (Kwon, Sungyong) 2011-09-24 2011 - CSI 21 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3745&ko_name=%EB%B0%95%ED%98%95%EC%A3%BC&paper_id=&key_name=%EB%B0%95%ED%98%95%EC%A3%BC&key_locale=in(Park, Hyungju) 2011-09-24 2011 - (Lee, Dongheun) 2011-09-24 2011 - http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=742&ko_name=%EC%84%9C%EB%8F%99%EC%97%BD&paper_id=&key_name=%EC%84%9C%EB%8F%99%EC%97%BD&key_locale=in(Suh, Dongyoup) 2011-09-24 KAIST Discrete Math Seminar - A conjecture on the (q,t)-binomial coefficients (Shishuo Fu) 2011-09-23 - ( ) 2011-09-23 2011 KAIST Math Colloquium - http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1051&ko_name=%EC%9C%84%EC%9D%B8%EC%88%99&paper_id=&key_name=%EC%9C%84%EC%9D%B8%EC%88%99&key_locale=in(Wee, Insuk) 2011-09-22 ASARC Seminar - Degenerations of Mixed Hodge Structure from a Tanakian viewpoint http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4564&ko_name=Patrick+brosnan&paper_id=(Patrick Brosnan) 2011-09-16 Coxeter Groups and Reflection Symmetry Ten Lectures by Jon McCammond - Coxeter Groups and Reflection Symmetry 10 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2696&ko_name=Jon+McCammond&paper_id=Jon(Jon McCammond) 2011-09-16 KAIST Discrete Math Seminar - Convex representations of Oriented Matroids http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4281&ko_name=Andreas+Holmsen&paper_id=&key_name=andreas&key_locale=in(Andreas Holmsen) 2011-09-16 Face the world with mathematical mind - Symmetry and Abstraction (Why do mathematicians see only 17 types of wall paper?) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2696&ko_name=Jon+McCammond&paper_id=Jon(Jon McCammond) 2011-09-15 Coxeter Groups and Reflection Symmetry Ten Lectures by Jon McCammond - Coxeter Groups and Reflection Symmetry 9 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2696&ko_name=Jon+McCammond&paper_id=Jon(Jon McCammond) 2011-09-15 Coxeter Groups and Reflection Symmetry Ten Lectures by Jon McCammond - Coxeter Groups and Reflection Symmetry 8 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2696&ko_name=Jon+McCammond&paper_id=Jon(Jon McCammond) 2011-09-14 Coxeter Groups and Reflection Symmetry Ten Lectures by Jon McCammond - Coxeter Groups and Reflection Symmetry 7 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2696&ko_name=Jon+McCammond&paper_id=Jon(Jon McCammond) 2011-09-09 - Impact of Sorption Processes to Kerogen on Groundwater Age-Dating Techniques Using Chlorofluorocarbons in Sedimentary Environments ( ) 2011-09-09 Coxeter Groups and Reflection Symmetry Ten Lectures by Jon McCammond - Coxeter Groups and Reflection Symmetry 6 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2696&ko_name=Jon+McCammond&paper_id=Jon(Jon McCammond) 2011-09-08 Coxeter Groups and Reflection Symmetry Ten Lectures by Jon McCammond - Coxeter Groups and Reflection Symmetry 5 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2696&ko_name=Jon+McCammond&paper_id=Jon(Jon McCammond) 2011-09-07 Coxeter Groups and Reflection Symmetry Ten Lectures by Jon McCammond - Coxeter Groups and Reflection Symmetry 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2696&ko_name=Jon+McCammond&paper_id=Jon(Jon McCammond) 2011-09-06 Coxeter Groups and Reflection Symmetry Ten Lectures by Jon McCammond - Coxeter Groups and Reflection Symmetry 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2696&ko_name=Jon+McCammond&paper_id=Jon(Jon McCammond) 2011-09-05 Coxeter Groups and Reflection Symmetry Ten Lectures by Jon McCammond - Coxeter Groups and Reflection Symmetry 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2696&ko_name=Jon+McCammond&paper_id=Jon(Jon McCammond) 2011-09-02 Coxeter Groups and Reflection Symmetry Ten Lectures by Jon McCammond - Coxeter Groups and Reflection Symmetry 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2696&ko_name=Jon+McCammond&paper_id=Jon(Jon McCammond) 2011-09-01 - (Choi, Sooil) 2011-09-01 - , http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=377&ko_name=%EA%B9%80%ED%99%8D%EC%A2%85&paper_id=&key_name=%EA%B9%80%ED%99%8D%EC%A2%85&key_locale=in(Kim, Hongjong) 2011-09-01 - http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=742&ko_name=%EC%84%9C%EB%8F%99%EC%97%BD&paper_id=&key_name=%EC%84%9C%EB%8F%99%EC%97%BD&key_locale=in(Suh, Dongyoup) 2011-09-01 The Arithmetic of Function Fields and Related Topics - Classification of bielliptic modular curves http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4071&ko_name=%EC%A0%84%EB%8C%80%EC%97%B4&paper_id=&key_name=%EC%A0%84%EB%8C%80%EC%97%B4&key_locale=in(Jeon, Daeyeol) 2011-08-19 The Arithmetic of Function Fields and Related Topics - Average values of L-functions in function fields http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4037&ko_name=%EC%A0%95%ED%99%98%EC%97%BD&paper_id=&key_name=%EC%A0%95%ED%99%98%EC%97%BD&key_locale=in(Jung, Hwanyup) 2011-08-19 The Arithmetic of Function Fields and Related Topics - Basis for the space of weakly holomorphic modular forms in higher level cases and its application http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3888&ko_name=%EA%B9%80%EC%B0%BD%ED%97%8C&paper_id=&key_name=%EA%B9%80%EC%B0%BD%ED%97%8C&key_locale=in(Kim, Changheon) 2011-08-19 The Arithmetic of Function Fields and Related Topics - Boundary maps to the supersingular points and the evaluation of Drinfeld modular Beilinson-Kato type elements (Satoshi Kondo) 2011-08-19 The Arithmetic of Function Fields and Related Topics - Hilbert genus fields of real biquadratic fields http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4272&ko_name=Qin+Yue&paper_id=(Qin Yue) 2011-08-19 The Arithmetic of Function Fields and Related Topics - Gauss sums over some matrix groups and their applications (Yan Li) 2011-08-18 The Arithmetic of Function Fields and Related Topics - Drinfeld modular forms and modular representation theory http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4551&ko_name=Ernst+Urlich+Gekeler&paper_id=(Ernst Urlich Gekeler) 2011-08-18 The Arithmetic of Function Fields and Related Topics - On metaplectic forms over function fields and an analogue of Waldspurger's formula (Fu-Tsun Wei) 2011-08-18 The Arithmetic of Function Fields and Related Topics - Diophantine Approximation in function fields http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4550&ko_name=Dinesh+Thakur&paper_id=(Dinesh Thakur) 2011-08-18 The Arithmetic of Function Fields and Related Topics - A p-adic view of multiple power sums (Kim, Minsoo) 2011-08-17 The Arithmetic of Function Fields and Related Topics - Note on the relation between prime generating polynomials and class number one problem for some number fields (Lee, Joonho) 2011-08-17 The Arithmetic of Function Fields and Related Topics - A class of algebraic differential equation that the Iwasawa power series does not satisfy (Sun, Haesang) 2011-08-17 The Arithmetic of Function Fields and Related Topics - On p-adic Hurwitz-type Euler zeta functions http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4274&ko_name=Su+Hu&paper_id=(Su Hu) 2011-08-17 The Arithmetic of Function Fields and Related Topics - Maass-Jacobi Forms http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=964&ko_name=%EC%96%91%EC%9E%AC%ED%98%84&paper_id=&key_name=%EC%96%91%EC%9E%AC%ED%98%84&key_locale=in(Yang, Jaehyun) 2011-08-17 The Arithmetic of Function Fields and Related Topics - Fermat quotient operators and locally analytic functions http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3716&ko_name=%EC%A0%95%EC%83%81%ED%83%9C&paper_id=&key_name=%EC%A0%95%EC%83%81%ED%83%9C&key_locale=in(Jeong, Sangtae) 2011-08-17 The Arithmetic of Function Fields and Related Topics - On v-adic periods of t-motives http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4562&ko_name=Yuichiro+Taguchi&paper_id=(Yuichiro Taguchi) 2011-08-17 The Arithmetic of Function Fields and Related Topics - Entire functions sharing simple a-points with their first derivative http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4561&ko_name=Andreas+Schweizer&paper_id=(Andreas Schweizer) 2011-08-17 The Arithmetic of Function Fields and Related Topics - On t-modules http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4650&ko_name=Jing+Yu&paper_id=(Jing Yu) 2011-08-17 The Arithmetic of Function Fields and Related Topics - Representations of integers by $x_1^2+2x_2^2+x_3^2+x_4^2+x_1x_3+x_1x_4+x_2x_4$ http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5087&ko_name=%EC%97%84%EC%9D%B5%EC%84%A0&paper_id=&key_locale=in(Eum, Icksun) 2011-08-16 The Arithmetic of Function Fields and Related Topics - Odd divisor functions formula derived from Weierstrass p-function. (Kim, Daeyeol) 2011-08-16 The Arithmetic of Function Fields and Related Topics - A Determinant formula for congruent zeta functions of abelian function fields http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3702&ko_name=%EC%95%88%EC%9E%AC%ED%98%84&paper_id=&key_name=%EC%95%88%EC%9E%AC%ED%98%84&key_locale=in(Ahn, Jaehyun) 2011-08-16 The Arithmetic of Function Fields and Related Topics - Mock theta functions via Ramanujan's reciprocity theorem http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3622&ko_name=%EA%B0%95%EC%88%9C%EC%9D%B4&paper_id=&key_name=%EA%B0%95%EC%88%9C%EC%9D%B4&key_locale=in(Kang, Soonyi) 2011-08-16 The Arithmetic of Function Fields and Related Topics - On a Goldbach-type question in F_q[t] (Andreas Bender) 2011-08-16 The Arithmetic of Function Fields and Related Topics - A basis for the space of weakly holomorphic Drinfeld modular forms http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4005&ko_name=%EC%B5%9C%EC%86%8C%EC%98%81&paper_id=&key_name=%EC%B5%9C%EC%86%8C%EC%98%81&key_locale=in(Choi, Soyoung) 2011-08-16 The Arithmetic of Function Fields and Related Topics - Coefficients and Hecke eigenvalues of Drinfeld modular forms (Cecile Armana) 2011-08-16 The Arithmetic of Function Fields and Related Topics - On Goss problem concerning the derivative modulo p of certain Artin L functions http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4549&ko_name=Bruno+Angles&paper_id=(Bruno Angles) 2011-08-16 2011 - 1998 2010 ( ) 2011-08-15 KAIST - Hamiltonian systems and invariant measures 2 (Tadahiro Oh) 2011-08-12 KAIST - Hamiltonian systems and invariant measures 1 (Tadahiro Oh) 2011-08-11 The 9th KAIST Geometric Topology Fair - Embedding finitely generated groups into finitely presented groups 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4542&ko_name=Mark+V.+Sapir&paper_id=(Mark V. Sapir) 2011-08-11 The 9th KAIST Geometric Topology Fair - Random rigidity in free groups 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3029&ko_name=Danny+Calegari&paper_id=Danny(Danny Calegari) 2011-08-11 The 9th KAIST Geometric Topology Fair - Simplicial volume and bounded group cohomology (Kim, Sungwoon) 2011-08-10 The 9th KAIST Geometric Topology Fair - Graph braid groups: its 10 year history http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2177&ko_name=%EA%B3%A0%EA%B8%B0%ED%98%95&paper_id=&key_name=%EA%B3%A0%EA%B8%B0%ED%98%95&key_locale=in(Ko, Kihyoung) 2011-08-10 The 9th KAIST Geometric Topology Fair - Recognizing low-dimensional manifold groups 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4541&ko_name=Jason+F.+Manning&paper_id=(Jason F. Manning) 2011-08-10 The 9th KAIST Geometric Topology Fair - Embedding finitely generated groups into finitely presented groups 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4542&ko_name=Mark+V.+Sapir&paper_id=(Mark V. Sapir) 2011-08-10 The 9th KAIST Geometric Topology Fair - Random rigidity in free groups 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3029&ko_name=Danny+Calegari&paper_id=Danny(Danny Calegari) 2011-08-10 The 9th KAIST Geometric Topology Fair - Embeddability between right-angled Artin groups (Kim, Sanghyun) 2011-08-09 The 9th KAIST Geometric Topology Fair - Combinatorial group theory applied to 2-bridge link groups http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3798&ko_name=%EC%9D%B4%EB%8F%99%ED%9D%AC&paper_id=&key_name=%EC%9D%B4%EB%8F%99%ED%9D%AC&key_locale=in(Lee Donghi) 2011-08-09 The 9th KAIST Geometric Topology Fair - Recognizing low-dimensional manifold groups 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4541&ko_name=Jason+F.+Manning&paper_id=(Jason F. Manning) 2011-08-09 The 9th KAIST Geometric Topology Fair - Asymptotic group theory - pro-p groups; property T and expansion 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4584&ko_name=Efim+Zelmanov&paper_id=(Efim Zelmanov) 2011-08-09 The 9th KAIST Geometric Topology Fair - Commensurizer group and its growth (Lim, Seonhee) 2011-08-08 The 9th KAIST Geometric Topology Fair - Asymptotic group theory - pro-p groups; property T and expansion 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4584&ko_name=Efim+Zelmanov&paper_id=(Efim Zelmanov) 2011-08-08 The 9th KAIST Geometric Topology Fair - Embedding finitely generated groups into finitely presented groups 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4542&ko_name=Mark+V.+Sapir&paper_id=(Mark V. Sapir) 2011-08-08 The 9th KAIST Geometric Topology Fair - Recognizing low-dimensional manifold groups 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4541&ko_name=Jason+F.+Manning&paper_id=(Jason F. Manning) 2011-08-08 The 9th KAIST Geometric Topology Fair - Random rigidity in free groups 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3029&ko_name=Danny+Calegari&paper_id=Danny(Danny Calegari) 2011-08-08 2011 Summer Workshop for Young Mathematicians in Korea - Model theory: Doing combinatorics in an infinite set (Kim, Hyeungjoon) 2011-08-05 2011 Summer Workshop for Young Mathematicians in Korea - Introduction to Hamiltonian Floer homology (Bae, Youngjin) 2011-08-04 ASARC Seminar - Weak Northcott property and the D-ratio for rational maps (Lee, Chonggyu) 2011-08-04 2011 Summer Workshop for Young Mathematicians in Korea - Introduction to Class Field Theory (Lee, Wan) 2011-08-04 2011 Summer Workshop for Young Mathematicians in Korea - Rational Homogeneous Manifold and its Rigidity (Park, Kyeongdong) 2011-08-04 2011 Summer Workshop for Young Mathematicians in Korea - Graph Domination (Lee, Hwangrae) 2011-08-04 2011 Summer Workshop for Young Mathematicians in Korea - Introduction to perfect graphs and x-boundedness of graphs (Kim, Ringi) 2011-08-03 2011 Summer Workshop for Young Mathematicians in Korea - Modular forms (Lim, Subong) 2011-08-03 2011 Summer Workshop for Young Mathematicians in Korea - Queueing Theory and its Application: Wireless Communication (Kim, Jaedeok) 2011-08-03 BK21 Seminar - Two Principles on Message Passing Networks (Shin, Jinwoo) 2011-07-28 KAIST Discrete Math Seminar - Characteristic polynomials and the Bergman fan of matroids (Huh, June) 2011-07-28 KAIST - Compactness http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4278&ko_name=%EA%B6%8C%EC%88%9C%EC%8B%9D&paper_id=&key_name=%EA%B6%8C%EC%88%9C%EC%8B%9D&key_locale=in(Kwon, Soonsik) 2011-07-26 KAIST - Topology of toric manifolds (Choi, Sooyoung) 2011-07-26 KAIST Discrete Math Seminar - Improved bound on the phase transition for independent sets in the square lattice http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4470&ko_name=Eric+Vigoda&paper_id=(Eric Vigoda) 2011-07-14 KAIST Discrete Math Seminar - Large and judicious bisections of graphs (Lee, Choongbum) 2011-07-07 ASARC Seminar - Orbifolds and Equivariant Geometry http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5090&ko_name=Tomoo+Matsumura&paper_id=(Tomoo Matsumura) 2011-06-27 Conference on Kinetic Theory and Related Fields - Emergence of multi-cluster configurations from attractive and repulsive interactions http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4178&ko_name=%EA%B0%95%EA%B2%BD%EA%B7%BC&paper_id=&key_name=%EA%B0%95%EA%B2%BD%EA%B7%BC&key_locale=in(Kang, Kyungkeun) 2011-06-24 Conference on Kinetic Theory and Related Fields - On the blow-up problem for the Euler equations and the Liouville type results in the fuid equations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=1831&ko_name=%EC%B1%84%EB%8F%99%ED%98%B8&paper_id=&key_name=%EC%B1%84%EB%8F%99%ED%98%B8&key_locale=in(Chae, Dongho) 2011-06-24 Conference on Kinetic Theory and Related Fields - Decay of an oscillating disk in a gas: Case of a collision-less gas and a special Lorentz gas http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4552&ko_name=Kazuo+Aoki&paper_id=(Kazuo Aoki) 2011-06-24 Conference on Kinetic Theory and Related Fields - Optimal large-time behavior of the Vlasov-Maxwell-Boltzmann system in the whole space http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4555&ko_name=Renjun+Duan&paper_id=(Renjun Duan) 2011-06-23 Conference on Kinetic Theory and Related Fields - The Doi Model for the Suspensions of Rod-like Molecules in a Compressible Fluid (Bae, Hantaek) 2011-06-23 Conference on Kinetic Theory and Related Fields - Mathematical analysis of the stationary motion of an incompressible viscous fluid http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4091&ko_name=%EA%B9%80%ED%98%84%EC%84%9D&paper_id=&key_name=%EA%B9%80%ED%98%84%EC%84%9D&key_locale=in(Kim, Hyunseok) 2011-06-23 Conference on Kinetic Theory and Related Fields - Global solutions to a non-local diffusion equation with quadratic non-linearity http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4553&ko_name=Robert+M.+Strain&paper_id=(Robert M. Strain) 2011-06-23 Conference on Kinetic Theory and Related Fields - The Vlasov-Landau-Poisson System in $T^\3$ http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4658&ko_name=Yan+Guo&paper_id=(Yan Guo) 2011-06-23 Conference on Kinetic Theory and Related Fields - The surface quasi-geostrophic and related equations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4556&ko_name=Jiahong+Wu&paper_id=(Jiahong Wu) 2011-06-23 Conference on Kinetic Theory and Related Fields - Large-time dynamics of particle models arising from flocking and synchronization http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3955&ko_name=%ED%95%98%EC%8A%B9%EC%97%B4&paper_id=&key_name=%ED%95%98%EC%8A%B9%EC%97%B4&key_locale=in(Ha, Seungyeal) 2011-06-23 Conference on Kinetic Theory and Related Fields - Asymptotic behavior of solutions to the VLASOV-poisson and VLASOV-maxwell equations in low dimension http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4557&ko_name=Robert+T.+Glassey&paper_id=(Robert T. Glassey) 2011-0623 Conference on Kinetic Theory and Related Fields - Copulas from Fokker-Planck equation http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=1949&ko_name=%EC%B5%9C%ED%9D%AC%EC%A4%80&paper_id=&key_pos=%EC%97%B0%EC%84%B8%EB%8C%80%ED%95%99%EA%B5%90&key_locale=in(Choe, Hijun) 2011-06-22 Conference on Kinetic Theory and Related Fields - Keller-Segel, Fast-Diffusion and Functional Inequalities http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4554&ko_name=Jos%C3%A9+Antonio+Carrill&paper_id=(Jose A. Carrillo) 2011-06-22 Conference on Kinetic Theory and Related Fields - Factorization of non-symmetric operators and appl. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4587&ko_name=Cl%C3%A9ment+Mouhot&paper_id=(Clement Mouhot) 2011-06-22 Conference on Kinetic Theory and Related Fields - Late-time behaviour of homogeneous solutions of he Einstein-Vlasov system http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4586&ko_name=Alan+D.+Rendall&paper_id=(Alan D. Rendall) 2011-06-22 Conference on Kinetic Theory and Related Fields - Being busy without a purpose is no better than just being lazy http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4112&ko_name=%EA%B9%80%EC%9A%A9%EC%A0%95&paper_id=&key_locale=in(Kim, Yongjung) 2011-06-22 Conference on Kinetic Theory and Related Fields - Rotating axially symmetric solutions of the Einstein-Vlasov system http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4560&ko_name=H%C3%A5kan+Andreasson&paper_id=(Hakan Andreasson) 2011-06-22 Conference on Kinetic Theory and Related Fields - Stability and Instability in a Collisionless Plasma http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4558&ko_name=Walter+Strauss&paper_id=(Walter A. Strauss) 2011-06-22 Intensive Lecture Series on PDE's - Aggregation in space/velocity in Mathematical Biology 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4554&ko_name=Jos%C3%A9+Antonio+Carrill&paper_id=(Jose A. Carrillo) 2011-06-21 Intensive Lecture Series on PDE's - Aggregation in space/velocity in Mathematical Biology 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4554&ko_name=Jos%C3%A9+Antonio+Carrill&paper_id=(Jose A. Carrillo) 2011-06-21 Intensive Lecture Series on PDE's - Boundary-value problems of the Boltzmann equation:Asymptotic and numerical analyses(Part 3) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4552&ko_name=Kazuo+Aoki&paper_id=(Kazuo Aoki) 2011-06-21 Intensive Lecture Series on PDE's - On the Boltzmann Equation, Part III:Optimal large-time decay rates for collisional kinetic equations in the whole space http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4553&ko_name=Robert+M.+Strain&paper_id=(Robert Strain) 2011-06-21 Intensive Lecture Series on PDE's - On the Boltzmann Equation without Angular Cut-O- Part II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4553&ko_name=Robert+M.+Strain&paper_id=(Robert Strain) 2011-06-20 Intensive Lecture Series on PDE's - On the Boltzmann Equation without Angular Cut-O- Part I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4553&ko_name=Robert+M.+Strain&paper_id=(Robert Strain) 2011-06-20 Intensive Lecture Series on PDE's - Boundary-value problems of the Boltzmann equation:Asymptotic and numerical analyses(Part 2) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4552&ko_name=Kazuo+Aoki&paper_id=(Kazuo Aoki) 2011-06-20 Intensive Lecture Series on PDE's - Boundary-value problems ofthe Boltzmann equation:Asymptotic and numerical analyses(Part 1) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4552&ko_name=Kazuo+Aoki&paper_id=(Kazuo Aoki) 2011-06-20 NIMS Hot Topics Workshop on Mathematical Cryptology - Verifiable Random Functions and Their Relation to Identity-Based Encryption http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4548&ko_name=Michel+Abdalla&paper_id=(Michel Abdalla) 2011-06-16 NIMS Hot Topics Workshop on Mathematical Cryptology - Efficient Fully Homomorphic Encryption from (Standard) LWE 6 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4546&ko_name=Vinod+Vaikuntanathan&paper_id=(Vinod Vaikuntanathan) 2011-06-16 NIMS Hot Topics Workshop on Mathematical Cryptology - Number Field Sieve over GF(p) of Low Hamming Weight Characteristic http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4547&ko_name=Tsuyoshi+Takagi&paper_id=(Tsuyoshi Takagi) 2011-06-16 NIMS Hot Topics Workshop on Mathematical Cryptology - A Fast Double-block-length Hash Function: MJH (Lee, Jooyoung) 2011-06-16 NIMS Hot Topics Workshop on Mathematical Cryptology - Efficient Fully Homomorphic Encryption from (Standard) LWE 5 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4546&ko_name=Vinod+Vaikuntanathan&paper_id=(Vinod Vaikuntanathan) 2011-06-15 NIMS Hot Topics Workshop on Mathematical Cryptology - Efficient Fully Homomorphic Encryption from (Standard) LWE 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4546&ko_name=Vinod+Vaikuntanathan&paper_id=(Vinod Vaikuntanathan) 2011-06-15 NIMS Hot Topics Workshop on Mathematical Cryptology - Efficient Fully Homomorphic Encryption from (Standard) LWE 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4546&ko_name=Vinod+Vaikuntanathan&paper_id=(Vinod Vaikuntanathan) 2011-06-15 NIMS Hot Topics Workshop on Mathematical Cryptology - Efficient Fully Homomorphic Encryption from (Standard) LWE 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4546&ko_name=Vinod+Vaikuntanathan&paper_id=(Vinod Vaikuntanathan) 2011-06-14 NIMS Hot Topics Workshop on Mathematical Cryptology - Efficient Fully Homomorphic Encryption from (Standard) LWE 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4546&ko_name=Vinod+Vaikuntanathan&paper_id=(Vinod Vaikuntanathan) 2011-06-14 - : ( ) 2011-06-10 Series Lectures on Seifert Fiberings by Kyung Bai Lee - Applications and #8211; Splitting spaces, Fixed point theory http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4544&ko_name=%EC%9D%B4%EA%B2%BD%EB%B0%B0&paper_id=&key_name=%EC%9D%B4%EA%B2%BD%EB%B0%B0&key_locale=in(Lee, Kyungbai) 2011-06-09 KAIST Discrete Math Seminar - The maximum size of a Sidon set contained in a sparse random set of integers (Lee, Sangjune) 2011-06-09 Series Lectures on Seifert Fiberings by Kyung Bai Lee - General Seifert Fibering and Generalization of Bieberbach Theorems http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4544&ko_name=%EC%9D%B4%EA%B2%BD%EB%B0%B0&paper_id=&key_name=%EC%9D%B4%EA%B2%BD%EB%B0%B0&key_locale=in(Lee, Kyungbai) 2011-06-08 Series Lectures on Seifert Fiberings by Kyung Bai Lee - Classical 3-dimensional Seifert manifolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4544&ko_name=%EC%9D%B4%EA%B2%BD%EB%B0%B0&paper_id=&key_name=%EC%9D%B4%EA%B2%BD%EB%B0%B0&key_locale=in(Lee, Kyungbai) 2011-06-07 ASARC Seminar - Classification of equivariant vector bundles over two-sphere (Kim, Minkyu) 2011-06-03 KAIST Discrete Math Seminar - Maximum hypergraphs without regular subgraphs (Kim, Jaehoon) 2011-06-03 2011 - Changes in EI Nino response to an increase of warm pool sea surface temperature ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - I - ( ) 2011-06-02 2011 - Influence of the Coriolis Force on the Formation of a Seasonal Thermocline (Yign Noh) 2011-06-02 2011 - Prediction of the Diurnal Warming of Sea surface Temperature Using the Atmosphere-Ocean Mixed Layer Coupled Model ( ) 2011-06-02 2011 - Taiwan Warm Current and Onshore Intrusion of Kuroshio ( ) 2011-06-02 2011 - Effects of the Changjiang freshwater on sea surface warming in the Yellow and East China Seas ( ) 2011-06-02 2011 - Seasonal and Non-seasonal Variations of Sea Surface Temperature in the Yellow Sea and East China Sea (Heung Jae Lie) 2011-06-02 2011 - Mapping the U.S. West Coast surface circulation: A multiyearanalysis of high-frequency radar observation (Sung Yong Kim) 2011-06-02 2011 - 2006~2009 ( ) 2011-06-02 2011 - Impacts of recurvature on typhoon-induced sea surface cooling ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - The Effect of Typhoon on Sea Water (Ecosystem) in the Upper Ocean (Chul Hoon Hong) 2011-06-02 2011 - Hydrodynamic response of coastal wateres of Korea to the typhoon KOMPASU (Hak Soo Lim) 2011-06-02 2011 - Characteristics of the Typhoon-Generated Surface Waves in the Western Coast of Korea (Ki Ryong Kang) 2011-06-02 2011 - Recent results on wave turbulence theory: statistical theory of wave-wave interactions based on random phase and amplitude formalism (Yeon Taek Choi) 2011-06-02 2011 - GOCI (tsunami) ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - 3D ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - (GDPS) (IOT) ( ) 2011-06-02 2011 - Gyrodiniellum shiwhaense n. gen., n. sp., (Gymnodiniaceae) from the coastal waters of Korea: morphology and ribosomal DNA gene sequence ( ) 2011-06-02 2011 - The thecate mixotrophic dinoflagellate Fragilidium duplocampanaeforme: feeding, prey specificity and allelopathy (Miran Kim) 2011-06-02 2011 - Evolution of Actin Gene Family in Dinoflagellates: Implications for phylogeny (Sun Ju Kim) 2011-06-02 2011 - Morphology and nuclear ribosomal DNA sequences of Prorocentrum koreanus sp. nov. from the Korean and Japanese coastal waters, and comparing with Prorocentrum micans (Prorocetrales, Dinophyceae) (Soo Yeon Cho) 2011-06-02 2011 - ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - Population dynamics of various ribotypes of Cochlodinium polykrikoides using novel development of Real-Time PCR assay based on EvaGreen ( ) 2011-06-02 2011 - Population dynamics of the microalgae Gymnodinium catenatum and Gymnodinium impudicum (Dinophyceaes) using EvaGreen-based quantitative Real-Time PCR assay ( ) 2011-06-02 2011 - Tintinnid species as biological sensors for monitoring the Kuroshio Extension in Korean coastal waters ( ) 2011-06-02 2011 - - CO - ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - GOCI ( ) 2011-06-02 2011 - Tracking the origin of the floating macroalgal blooms in Korea during the summer of 2008 and 2009 ( ) 2011-06-02 2011 - (Ruditapes philippinarum) ( ) 2011-06-02 2011 - 16S rRNA gene sequences detected by denaturing gradient gel electrophoresis in the East Sea during 2007-2009 ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - 1. , , , ( ) 2011-06-02 2011 - Impacts of enhanced atmospheric CO2 concentration and high temperature on photosynthesis, calcification and growth of Coralline alga Corallina officinalis (N. Sao Mai Lam) 2011-06-02 2011 - 2006 , ( ) 2011-06-02 2011 - Feeding by mixotrophic dinoflagellate Woloszynskia cincta on various preys from western Korean waters: Feeding mechanism, prey species, and effect of prey concentration ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - (GSTA) ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - Late Quaternary inner shelf sequence in a river-dominated environmental setting: an example from Nakdong inner shelf ( ) 2011-06-02 2011 - Shallow seismic stratigraphy and geotechnical properties of the eastern boundary of the Korea Strait shelf mud off southeast Korea (G. Turkdemir) 2011-06-02 2011 - 3D seismic interpretation of seismic chimney structure in the Ulleung Basin, East Sea ( ) 2011-06-02 2011 - The effective source wavelet extraction method to seismic inversion ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - Korea KNRV5000 Building Program (Bong Chool Suk) 2011-06-02 2011 - ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - 1. ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - : ( ) 2011-06-02 2011 - Longshore Bar ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - mesocosm ( ) 2011-06-02 2011 - : mesocosm ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - Factors Affecting Concentration and Chemical Composition of Petroleum Hydrocarbons in Water Accommodated Fractions (WAF) of Iranian Heavy Crude Oil ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - ( ) 2011-06-02 2011 - ( ) 2011-06-02 BK21 Seminar - A quasilinear elliptic Dirichlet problem having two positive solutions http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4545&ko_name=Charles+A.+Stuart&paper_id=(Charles Stuart) 2011-06-01 - : ( ) ( ) 2011-05-27 KAIST Discrete Math Seminar - Usage of Balloons in Regular Graphs (O,Suil) 2011-05-26 - Large explosive eruptions in the Roman province(Central Italy) (Matteo Masotta) 2011-05-20 - Age determination of rocks : New perspectives (Dr. Sajeev Krishnan) 2011-05-20 2011 KAIST Math Colloquium - (Chung, Yeonseung) 2011-05-19 ASARC Seminar - Hilbert scheme of points. Mini lecture III (Lee, Hwayoung) 2011-05-17 Basic Notions Seminar - (Affine) Scheme for Everybody (Marco Antei) 2011-05-13 - 5 ( ) 2011-05-13 ASARC Seminar - Hilbert scheme of points. Mini lecture II (Lee, Hwayoung) 2011-05-11 KAIST Graph Theory Day 2011 - Colouring Tournaments http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4453&ko_name=Paul+Seymour&paper_id=(Paul Seymour) 2011-05-10 KAIST Graph Theory Day 2011 - On the chromatic number of digraphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4532&ko_name=Bojan+Mohar&paper_id=(Bojan Mohar) 2011-05-10 KAIST Graph Theory Day 2011 - A separator theorem in minor-closed class of graphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4362&ko_name=Ken-ichi+Kawarabayas&paper_id=(Kenichi-Kawarabayashi) 2011-05-10 KAIST Graph Theory Day 2011 - Coloring some perfect graphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4454&ko_name=Maria+Chudnovsky&paper_id=(Maria Chudnovsky) 2011-05-10 Intensive Lectures by Miles Reid - Intensive Lectures 11 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2011-05-07 Intensive Lectures by Miles Reid - Intensive Lectures 10 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2011-05-07 2011 KAIST Math Colloquium - Modular curves and their applications to elliptic curves http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3888&ko_name=%EA%B9%80%EC%B0%BD%ED%97%8C&paper_id=&key_name=%EA%B9%80%EC%B0%BD%ED%97%8C&key_locale=in(Kim, Changheon) 2011-05-06 - Thermochemistry and crystallization behavior of materials relevant to nuclear energy ( ) 2011-05-06 ASARC Seminar - Hilbert scheme of points. Mini lecture I (Lee, Hwayoung) 2011-05-03 Intensive Lectures by Miles Reid - Intensive Lectures 9 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2011-04-23 Intensive Lectures by Miles Reid - Intensive Lectures 8 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2011-04-23 KAIST Discrete Math Seminar - Fractional colouring of product graphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4531&ko_name=Xuding+Zhu&paper_id=(Xuding Zhu) 2011-04-22 2011 KAIST Math Colloquium - Circular colouring of graphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4531&ko_name=Xuding+Zhu&paper_id=(Xuding Zhu) 2011-04-21 KAIST - 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4229&ko_name=%EC%97%84%EC%83%81%EC%9D%BC&paper_id=&key_name=%EC%97%84%EC%83%81%EC%9D%BC&key_locale=in(Oum, Sangil) 2011-04-19 Intensive Lectures by Gavin Brown - Intensive Lectures 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4659&ko_name=Gavin+Brown&paper_id=(Gavin Brown) 2011-04-16 Intensive Lectures by Gavin Brown - Intensive Lectures 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4659&ko_name=Gavin+Brown&paper_id=(Gavin Brown) 2011-04-16 Differential Geometry Seminar - Algebraic QFT and Quantum Homotopy Invariants http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3921&ko_name=%EB%B0%95%EC%9E%AC%EC%84%9D&paper_id=&key_name=%EB%B0%95%EC%9E%AC%EC%84%9D&key_locale=in(Park, Jaesuk) 2011-04-15 Basic Notions Seminar - Introduction to Algebraic Quantum Field Theory http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3921&ko_name=%EB%B0%95%EC%9E%AC%EC%84%9D&paper_id=&key_name=%EB%B0%95%EC%9E%AC%EC%84%9D&key_locale=in(Park, Jaesuk) 2011-04-15 ASARC Seminar - A bound on the degree of scheme defined by quadratic equations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4540&ko_name=Jos%C3%A9+Carlos+Sierra&paper_id=(Jose Carlos Sierra) 2011-04-15 KAIST Discrete Math Seminar - A generalization of Kakeya's problem http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4536&ko_name=Otfried+Cheong&paper_id=&key_name=Otfried&key_locale=in(Otfried Cheong) 2011-04-14 ASARC Seminar - On the quadratic normality and the triple curve of 3-dimensional subvarieties of P^5 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4540&ko_name=Jos%C3%A9+Carlos+Sierra&paper_id=(Jose Carlos Sierra) 2011-04-13 ASARC Seminar - Tangential projections and secant defective varieties http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4540&ko_name=Jos%C3%A9+Carlos+Sierra&paper_id=(Jose Carlos Sierra) 2011-04-12 Intensive Lectures by Gavin Brown - Intensive Lectures 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4659&ko_name=Gavin+Brown&paper_id=(Gavin Brown) 2011-04-09 Intensive Lectures by Miles Reid - Intensive Lectures 7 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2011-04-09 - ( ) 2011-04-08 2011 KAIST Math Colloquium - Korean mathemaics between 1894 to 1945 (Lee, Sanggu) 2011-04-07 Differential Geometry Seminar - Introduction to Quantum singularity theory II (Fan Huijun) 2011-04-07 Basic Notions Seminar - Introduction to Quantum singularity theory I (Fan Huijun) 2011-04-05 - 3 ( ) 2011-04-01 2011 NIMS Hot Topics Workshop Computational Aspects of Birational Geometry - Special Galois coverings and the irreducibility of certain spaces of coverings of curves with applic http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4537&ko_name=Fabrizio+Catanese&paper_id=(Fabrizio Catanese) 2011-03-31 2011 NIMS Hot Topics Workshop Computational Aspects of Birational Geometry - On del Pezzo surfaces with canonical singularities (Won, joonyeong) 2011-03-31 2011 NIMS Hot Topics Workshop Computational Aspects of Birational Geometry - Asymptotic behaviour of regularity of power of ideal http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4538&ko_name=Kazuhiko+Kurano&paper_id=(Kazuhiko Kurano) 2011-03-31 2011 NIMS Hot Topics Workshop Computational Aspects of Birational Geometry - Extremal Laurent polynomials and Fano manifolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4528&ko_name=Alessio+Corti&paper_id=(Alessio Corti) 2011-03-31 2011 NIMS Hot Topics Workshop Computational Aspects of Birational Geometry - Codimension 4 Gorenstein varieties http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2011-03-31 2011 NIMS Hot Topics Workshop Computational Aspects of Birational Geometry - Z-affine transformations and families of K3 hypersurfaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4530&ko_name=Masanori+Kobayashi&paper_id=(Masanori Kobayashi) 2011-03-30 2011 NIMS Hot Topics Workshop Computational Aspects of Birational Geometry - Slope stability of Fano manifolds with respect to smooth subcurves (Kim, Hosung) 2011-03-30 2011 NIMS Hot Topics Workshop Computational Aspects of Birational Geometry - On the geometry of quasi lines http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4529&ko_name=Paltin+Ionescu&paper_id=(Paltin Ionescu) 2011-03-30 2011 NIMS Hot Topics Workshop Computational Aspects of Birational Geometry - Projective varieties whose generic inner projections have exceptional divisors http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4384&ko_name=Atsushi+Noma&paper_id=(Atsushi Noma) 2011-03-30 2011 NIMS Hot Topics Workshop Computational Aspects of Birational Geometry - On special birational transformations of projective spaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4540&ko_name=Jos%C3%A9+Carlos+Sierra&paper_id=(Jose Carlos Sierra) 2011-03-30 2011 NIMS Hot Topics Workshop Computational Aspects of Birational Geometry - Syzygies of abelian varieties http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4588&ko_name=Giuseppe+Pareschi&paper_id=(Giusepp Pareschi) 2011-03-30 2011 NIMS Hot Topics Workshop Computational Aspects of Birational Geometry - Derived McKay correspondence in dimensions 4 and above http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4539&ko_name=Timothy+Logvinenko&paper_id=(Timothy Logvinenko) 2011-03-29 2011 NIMS Hot Topics Workshop Computational Aspects of Birational Geometry - The Sarkisov Program for terminal quartic 3-folds (Anne-Sophie Kaloghiros) 2011-03-29 2011 NIMS Hot Topics Workshop Computational Aspects of Birational Geometry - On quadratic residue curves and its application http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4589&ko_name=Hiroo+Tokunaga&paper_id=(Hiroo Tokunaga) 2011-03-29 2011 NIMS Hot Topics Workshop Computational Aspects of Birational Geometry - Moduli spaces of quasi-maps to projective space with perfect obstruction theories http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4231&ko_name=%EA%B9%80%EC%98%81%ED%9B%88&paper_id=&key_name=%EA%B9%80%EC%98%81%ED%9B%88&key_locale=in(Kiem, Younghoon) 2011-03-29 2011 NIMS Hot Topics Workshop Computational Aspects of Birational Geometry - Understanding cohomology classes of algebraic varieties by slicing them up http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4527&ko_name=Herb+Clemens&paper_id=(Herb Clemens) 2011-03-29 ASARC Seminar - Intensive lectures on projective geometry IV-Manifolds covered by lines http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4529&ko_name=Paltin+Ionescu&paper_id=(Paltin Ionescu) 2011-03-28 ASARC Seminar - Intensive lectures on projective geometry III-Defective manifolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4529&ko_name=Paltin+Ionescu&paper_id=(Paltin Ionescu) 2011-03-25 2011 KAIST Math Colloquium - Knots in dimension three and topology of dimension four http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3904&ko_name=%EC%B0%A8%EC%9E%AC%EC%B6%98&paper_id=&key_name=%EC%B0%A8%EC%9E%AC%EC%B6%98&key_locale=in(Cha, Jaechoon) 2011-03-24 ASARC Seminar - Intensive lectures on projective geometry II-Manifolds of VERY small codimension http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4529&ko_name=Paltin+Ionescu&paper_id=(Paltin Ionescu) 2011-03-23 ASARC Seminar - Intensive lectures on projective geometry I-Manifolds of small codimension http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4529&ko_name=Paltin+Ionescu&paper_id=(Paltin Ionescu) 2011-03-22 Intensive Lectures by Miles Reid - Intensive Lectures 6 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2011-03-19 Intensive Lectures by Miles Reid - Intensive Lectures 5 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2011-03-19 Knots and Spatial Graphs 2011 - Twisted torus knots which are unknotted http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4270&ko_name=%EC%9D%B4%EC%83%81%EC%97%BD&paper_id=&key_name=%EC%9D%B4%EC%83%81%EC%97%BD&key_locale=in(Lee, Sangyop) 2011-03-18 Knots and Spatial Graphs 2011 - Flat embeddings of graphs into the 3-space http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3899&ko_name=%ED%97%88%EC%98%81%EC%8B%9D&paper_id=&key_name=%ED%97%88%EC%98%81%EC%8B%9D&key_locale=in(Huh,Youngsik) 2011-03-18 Knots and Spatial Graphs 2011 - Meanders and two component brunnian links (Jeon, Choonbae) 2011-03-18 Knots and Spatial Graphs 2011 - Quadrisecant approximation of heptagonal figure eight knots (Park, Seojung) 2011-03-18 Knots and Spatial Graphs 2011 - Prime knots of arc index 12 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1818&ko_name=%EC%A7%84%EA%B5%90%ED%83%9D&paper_id=&key_name=%EC%A7%84%EA%B5%90%ED%83%9D&key_locale=in(Jin, Gyotaek) 201103-18 Knots and Spatial Graphs 2011 - Inequivalent handlebody knots with homeomorphic compleme (Lee, Junghoon) 2011-03-17 KAIST Discrete Math Seminar - L(j,k) Labelings of Direct Product of Complete Graphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3938&ko_name=%EB%85%B8%EC%9C%A0%EB%AF%B8&paper_id=&key_name=%EB%85%B8%EC%9C%A0%EB%AF%B8&key_locale=in(Rho, Yoomi) 2011-03-17 Intensive Lectures by Miles Reid - Intensive Lectures 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2011-03-12 Intensive Lectures by Miles Reid - Intensive Lectures 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2011-03-12 - Atmospheric CO2 and Abrupt Climate Change During the Last Glacial Period ( ) 2011-03-11 KAIST Discrete Math Seminar - Decomposition of Sparse Graphs into Forests and a Graph with Bounded Degree http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3837&ko_name=%EA%B9%80%EC%84%9D%EC%A7%84&paper_id=&key_name=%EA%B9%80%EC%84%9D%EC%A7%84&key_locale=in(Kim, Seogjin) 2011-03-10 2011 KAIST Math Colloquium - The Circle and Divisor Problems, Bessel Function Series, and Weighted Divisor Sums http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4516&ko_name=Bruce+C.+Berndt&paper_id=(Bruce C. Berndt) 2011-03-07 Intensive Lectures by Miles Reid - Intensive Lectures 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2011-03-05 Intensive Lectures by Miles Reid - Intensive Lectures 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2011-03-05 KIAS/SNU International Conference on Complex and Symplectic Geometry - Fake Projective Planes http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2259&ko_name=%EA%B8%88%EC%A2%85%ED%95%B4&paper_id=&key_name=%EA%B8%88%EC%A2%85%ED%95%B4&key_locale=in(Keum, Jonghae) 2011-03-03 KIAS/SNU International Conference on Complex and Symplectic Geometry - Higher order curvature inequalities and the radius of a Grauert tube. (Raul Agiular) 2011-03-03 KIAS/SNU International Conference on Complex and Symplectic Geometry - A type of Leftschetz Hyperplane section theorem on Q-Fano 3-folds with Picard number one and $ frac{1}{2}(1,1,1)$ singularities (Lee, Namhoon) 2011-03-03 KIAS/SNU International Conference on Complex and Symplectic Geometry - Generalized complex structures in geometric Langlands http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=370&ko_name=%EA%B9%80%ED%98%B8%EC%9D%BC&paper_id=&key_name=%EA%B9%80%ED%98%B8%EC%9D%BC&key_locale=in(Kim, Hoil) 2011-03-03 KIAS/SNU International Conference on Complex and Symplectic Geometry - Grauert tubes and some applications. (Kan, Sujen) 2011-03-03 KIAS/SNU International Conference on Complex and Symplectic Geometry - Quasi-linear system of PDEs of first order http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=1998&ko_name=%ED%95%9C%EC%A2%85%EA%B7%9C&paper_id=&key_name=%ED%95%9C%EC%A2%85%EA%B7%9C&key_locale=in(Han, Chongkyu) 2011-03-03 KIAS/SNU International Conference on Complex and Symplectic Geometry - Some obstructions to symplectic embeddings http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4524&ko_name=Richard+Hind&paper_id=(Richard Hind) 2011-03-02 KIAS/SNU International Conference on Complex and Symplectic Geometry - Non-compact symplectic toric manifolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4523&ko_name=Eugene+Lerman&paper_id=(Eugene Lerman) 2011-03-02 KIAS/SNU International Conference on Complex and Symplectic Geometry - Wall-crossings for Twisted Quiver Bundles http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2339&ko_name=%EA%B9%80%EB%B2%94%EC%8B%9D&paper_id=&key_name=%EA%B9%80%EB%B2%94%EC%8B%9D&key_locale=in(Kim, Bumsig) 2011-03-01 KIAS/SNU International Conference on Complex and Symplectic Geometry - Lagrangian Floer theory on toric orbifolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4232&ko_name=%EC%A1%B0%EC%B2%A0%ED%98%84&paper_id=&key_name=%EC%A1%B0%EC%B2%A0%ED%98%84&key_locale=in(Cho, Cheolhyun) 2011-03-01 KIAS/SNU International Conference on Complex and Symplectic Geometry - Rabinowitz Floer homology http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4522&ko_name=Urs+Frauenfelder&paper_id=&key_name=urs&key_locale=in(Urs Frauenfelder) 2011-03-01 KIAS/SNU International Conference on Complex and Symplectic Geometry - Spectral theory for the dbar-Neumann Laplacian http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4519&ko_name=Siqi+Fu&paper_id=(Sigi Fu) 2011-02-28 KIAS/SNU International Conference on Complex and Symplectic Geometry - Syzygies of compact complex hyperbolic manifolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2086&ko_name=%ED%99%A9%EC%A4%80%EB%AC%B5&paper_id=&key_name=%ED%99%A9%EC%A4%80%EB%AC%B5&key_locale=in(Hwang, Junmuk) 2011-02-28 KIAS/SNU International Conference on Complex and Symplectic Geometry - Semicontinuity theorems for automorphism groups http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2267&ko_name=%EA%B9%80%EA%B0%95%ED%83%9C&paper_id=&key_name=%EA%B9%80%EA%B0%95%ED%83%9C&key_locale=in(Kim, Kangtae) 2011-02-28 KIAS/SNU International Conference on Complex and Symplectic Geometry - Totally Real Immersions http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4518&ko_name=Howard+Jacobowitz&paper_id=(Howard Jacobowitz) 2011-02-28 KIAS/SNU International Conference on Complex and Symplectic Geometry - Toric Degenerations and Exact Bohr-Sommerfeld Correspondences http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4517&ko_name=Daniel+Burns&paper_id=(Daniel Burns) 2011-02-28 Korea PDE School - Krylov-Safanov Theory for Nondivergence type Equation 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3937&ko_name=%EC%9D%B4%EA%B8%B0%EC%95%94&paper_id=&key_name=%EC%9D%B4%EA%B8%B0%EC%95%94&key_locale=in(Lee, Kiahm) 2011-02-26 Korea PDE School - Directed Movements http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4514&ko_name=Wei-Ming+Ni&paper_id=(Wei-Ming Ni) 2011-02-26 Korea PDE School - Ansatz solutions to a problem of mean curvature and Newtonian potential http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4515&ko_name=Xiaofeng+Ren&paper_id=(Xiaofeng Ren) 2011-02-25 Korea PDE School - Krylov-Safanov Theory for Nondivergence type Equation 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3937&ko_name=%EC%9D%B4%EA%B8%B0%EC%95%94&paper_id=&key_name=%EC%9D%B4%EA%B8%B0%EC%95%94&key_locale=in(Lee, Kiahm) 2011-02-25 Korea PDE School - Lotka-Volterra Weak Competition Systems http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4514&ko_name=Wei-Ming+Ni&paper_id=(Wei-Ming Ni) 2011-02-25 2011 KAIST Math Colloquium - Diffusion and Directed Movements in Heterogeneous Environments http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4514&ko_name=Wei-Ming+Ni&paper_id=(Wei-Ming Ni) 2011-02-24 Korea PDE School - (Whang, Ickho) 2011-02-24 Korea PDE School - De Giorgi Theory for Divergence type Equation 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3937&ko_name=%EC%9D%B4%EA%B8%B0%EC%95%94&paper_id=&key_name=%EC%9D%B4%EA%B8%B0%EC%95%94&key_locale=in(Lee, Kiahm) 2011-02-24 Korea PDE School - Slower Diffuser Always Prevails http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4514&ko_name=Wei-Ming+Ni&paper_id=(Wei-Ming Ni) 2011-02-24 Korea PDE School - Energy solution to nonlinear wave equation (Huh, Hyungjin) 2011-02-23 Korea PDE School - On diffraction managed non-linear discrete Schr\ (Lee, Youngran) 2011-02-23 Korea PDE School - Spike-layer Solutions to Singularly Perturbed Semilinear Systems of Coupled Schr odinger Equations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4591&ko_name=Zhongwei+Tang&paper_id=(Zhongwei Tang) 2011-02-23 Korea PDE School - On Hessian equations of Lane-Emden type (Bae, Soohyun) 2011-02-23 Korea PDE School - De Giorgi Theory for Divergence type Equation 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3937&ko_name=%EC%9D%B4%EA%B8%B0%EC%95%94&paper_id=&key_name=%EC%9D%B4%EA%B8%B0%EC%95%94&key_locale=in(Lee, Kiahm) 2011-02-23 Korea PDE School - The Logistic Equation http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4514&ko_name=Wei-Ming+Ni&paper_id=(Wei-Ming Ni) 2011-02-23 Korea PDE School - Schauder theory http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3937&ko_name=%EC%9D%B4%EA%B8%B0%EC%95%94&paper_id=&key_name=%EC%9D%B4%EA%B8%B0%EC%95%94&key_locale=in(Lee, Kiahm) 2011-02-22 Korea PDE School - Introduction and Overview http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4514&ko_name=Wei-Ming+Ni&paper_id=(Wei-Ming Ni) 2011-02-22 BK21 Seminar - Trading and Hedging Volatility http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4121&ko_name=%EC%A0%84%EC%9D%B8%ED%83%9C&paper_id=&key_name=%EC%A0%84%EC%9D%B8%ED%83%9C&key_locale=in(Jeon, Intae) 2011-02-15 2011 - PDF (Yoon, Seokchun) 2011-02-12 2011 - (Cho, Jinhwan) 2011-02-12 2011 - The Magic of MathJax (Nam, Soojin) 2011-02-12 2011 - (Lee, Hojae) 2011-02-12 2011 - tabu (Lee, Juho) 2011-02-12 2011 - LuaLaTeX LuaTeX-ko (kim, Dohyun) 2011-02-12 2011 KAIST Math Colloquium - Hybrid discontinuous Galerkin methods for elliptic problems http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=1599&ko_name=%EC%A0%84%EC%98%81%EB%AA%A9&paper_id=&key_name=%EC%A0%84%EC%98%81%EB%AA%A9&key_locale=in(Jeon, Youngmok) 2011-02-10 KAIST Discrete Math Seminar - Forbidden induced subgraphs of double-split graphs (Kim, Ilhee) 2011-01-07 KAIST - [ ]2-variable p-adic L-functions for non-ordinary primes (Kim, Byungdoo) 2011-01-05 - 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2267&ko_name=%EA%B9%80%EA%B0%95%ED%83%9C&paper_id=&key_name=%EA%B9%80%EA%B0%95%ED%83%9C&key_locale=in(Kim, Kangtae) 2011-01-03 - 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2267&ko_name=%EA%B9%80%EA%B0%95%ED%83%9C&paper_id=&key_name=%EA%B9%80%EA%B0%95%ED%83%9C&key_locale=in(Kim, Kangtae) 2011-01-03 2009 - ( ) 2009-05-22 Back to top of page 2010 Topology Seminar - Hyperbolic Surface Subgroups of One-Ended Doubles of Free Groups (Kim, Sanghyun) 2010-12-23 KAIST Discrete Math Seminar - Triangulations of Product of Simplices and Tropical Oriented Matroid http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=5100&ko_name=%EC%9C%A0%ED%99%98%EC%B2%A0&paper_id=&key_locale=in(Yoo, Hwanchul) 2010-12-22 Differential Geometry Seminar - Cohomology ring and quantum cohomology of Hilbert schemes http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4662&ko_name=Wei-Ping+Li&paper_id=(Wei-Ping Li) 2010-12-10 KAIST Discrete Math Seminar - Helly numbers and nerve theorems http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4661&ko_name=Xavier+Goaoc&paper_id=(Xavier Goaoc) 2010-12-10 - ( ) 2010-12-10 Basic Notions Seminar - Infinite dimensional Lie algebras and Hilbert schemes http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4662&ko_name=Wei-Ping+Li&paper_id=(Wei-Ping Li) 2010-12-09 Differential Geometry Seminar - Contact homology and fillings (Otto Van Koert) 2010-12-03 ASARC Seminar - On the coefficients of weakly holomorphic Drinfeld modular forms http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4005&ko_name=%EC%B5%9C%EC%86%8C%EC%98%81&paper_id=&key_locale=in(Choi, Soyoung) 2010-12-03 - - 1 ( ) 2010-12-03 - - 2 ( ) 2010-12-03 Seoul-Tokyo Conference on Arithmetic and Algebraic Geometry - Introduction to the abundance conjecture http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4507&ko_name=Yujiro+Kawamata&paper_id=(Yujiro Kawamata) 2010-11-27 Seoul-Tokyo Conference on Arithmetic and Algebraic Geometry - Simply connected surfaces of general type with vanishing geometric genus in positive characteristic via deformation theory http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3951&ko_name=%EC%9D%B4%EC%9A%A9%EB%82%A8&paper_id=&key_name=%EC%9D%B4%EC%9A%A9%EB%82%A8&key_locale=in(Lee, Yongnam) 2010-11-27 Seoul-Tokyo Conference on Arithmetic and Algebraic Geometry - Relative completion and Beilinson conjecture for Kuga fiber space. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4510&ko_name=Tomohide+Terasoma&paper_id=(Tomohdie Terasoma) 2010-11-27 Seoul-Tokyo Conference on Arithmetic and Algebraic Geometry - Toward a geometric construction of fake projective planes http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2259&ko_name=%EA%B8%88%EC%A2%85%ED%95%B4&paper_id=&key_name=%EA%B8%88%EC%A2%85%ED%95%B4&key_locale=in(Keum, Jonghae) 2010-11-27 Seoul-Tokyo Conference on Arithmetic and Algebraic Geometry - Bogomolov-Miyaoka-Yau inequalities --- variants and applications http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4508&ko_name=Yoichi+Miyaoka&paper_id=(Yoichi Miyaoka) 2010-11-27 Seoul-Tokyo Conference on Arithmetic and Algebraic Geometry - Deformation of the space of lines on the 5-dimensional hyperquadric. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2086&ko_name=%ED%99%A9%EC%A4%80%EB%AC%B5&paper_id=&key_name=%ED%99%A9%EC%A4%80%EB%AC%B5&key_locale=in(Hwang, Junmuk) 2010-11-27 Seoul-Tokyo Conference on Arithmetic and Algebraic Geometry - The Classification of Enriques Surfaces (Christian Liedtke) 2010-11-26 Seoul-Tokyo Conference on Arithmetic and Algebraic Geometry - Configurations of rational curves on supersingular K3 surfaces in small characteristics (Toshiyuki Katsura) 2010-11-26 Seoul-Tokyo Conference on Arithmetic and Algebraic Geometry - Tangential localization and duality for Selmer varieties. (Kim, Minhyong) 2010-11-26 Seoul-Tokyo Conference on Arithmetic and Algebraic Geometry - Wild ramification of schemes and sheaves http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4509&ko_name=Takeshi+Saito&paper_id=(Takeshi Saito) 2010-11-26 Seoul-Tokyo Conference on Arithmetic and Algebraic Geometry - Some cycle groups with respect to hyperplane arrangements http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4295&ko_name=%EB%B0%95%EC%A7%84%ED%98%84&paper_id=&key_name=%EB%B0%95%EC%A7%84%ED%98%84&key_locale=in(Park, Jinhyun) 2010-11-26 Seoul-Tokyo Conference on Arithmetic and Algebraic Geometry - Cohomological Hasse principle and resolution of singularities. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4322&ko_name=Shuji+Saito&paper_id=(Shuji Saito) 2010-11-26 2010 KAIST Math Colloquium - 2-variable p-adic L-functions for non-ordinary primes (Lee, Hyungchun) 2010-11-25 KAIST Discrete Math Seminar - On q-enumeration of permutations (Shin, Heesung) 2010-11-19 - Allocating Risk Capital for a Brownfields Redevelopment Project under Hydrogeological and Financial Uncertainty ( ) 2010-11-19 2010 KAIST Math Colloquium - Computations in algebraic geometry: algorithms, complexity and applications http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4314&ko_name=%ED%98%84%EB%8F%99%ED%9B%88&paper_id=&key_name=%ED%98%84%EB%8F%99%ED%9B%88&key_locale=in(Hyeon, Donghoon) 2010-11-11 - Great Eruption of Changbaishan( ) Volcano ( (Prof. Jin Xu)) 2010-11-08 The 14th International Workshop on Differential Geometry - On relation between potentials for pluriharmonic maps and para-pluriharmonic maps http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4504&ko_name=Nobutaka+Boumuki&paper_id=(Nobutaka Boumuki) 2010-11-06 The 14th International Workshop on Differential Geometry - Real hypersurfaces in complex two-place Grassmannians with D-parallel structure Jacobi operator (Jeong, Imsoon) 2010-11-06 The 14th International Workshop on Differential Geometry - Historical backgrounds of the 14th and GRG http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=751&ko_name=%EC%84%9C%EC%98%81%EC%A7%84&paper_id=&key_name=%EC%84%9C%EC%98%81%EC%A7%84&key_locale=in(Suh, Youngjin) 2010-11-05 The 14th International Workshop on Differential Geometry - Transversal infinitesional automorphisms and applications on foliated monafolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=1655&ko_name=%EC%A0%95%EC%8A%B9%EB%8B%AC&paper_id=&key_name=%EC%A0%95%EC%8A%B9%EB%8B%AC&key_locale=in(Jung, Seoungdal) 2010-11-05 The 14th International Workshop on Differential Geometry - Homogeneity of an equfocal submanifold and a proper complex equifocal submanifold II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4503&ko_name=Naoyuki+Koike&paper_id=(Naoyuki Koike) 2010-11-05 The 14th International Workshop on Differential Geometry - Symmetric mixed homothetic deficit http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4762&ko_name=Jiazu+Zhou&paper_id=(Jiazu Zhou) 2010-11-05 The 14th International Workshop on Differential Geometry - On the 5-dimensional Sasaki-Einstein manifolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=30&ko_name=%EA%B9%80%EB%B3%91%ED%95%99&paper_id=&key_name=%EA%B9%80%EB%B3%91%ED%95%99&key_locale=in(Kim, Byunghak) 2010-11-05 The 14th International Workshop on Differential Geometry - Hypersurfaces in Symmetric spaces II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4380&ko_name=Jurgen+Berndt&paper_id=(Jurgen Berndt) 2010-11-05 The 14th International Workshop on Differential Geometry - Geometry of Lagrangian submanifolds and isoparametric hypersurfaces II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4502&ko_name=Yoshihiro+Ohnita&paper_id=(Yoshihiro Ohnita) 2010-11-05 - ( ) 2010-11-05 The 14th International Workshop on Differential Geometry - On integral geometric inequalities http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4762&ko_name=Jiazu+Zhou&paper_id=(Jiazu Zhou) 2010-11-04 KAIST Discrete Math Seminar - Distance-Regular Graphs and Potential Theory (Greg Markowsky) 2010-11-04 The 14th International Workshop on Differential Geometry - Jacobi fields in geodesic surface congruences http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=1762&ko_name=%EC%A1%B0%EC%9A%A9%EC%8A%B9&paper_id=&key_name=%EC%A1%B0%EC%9A%A9%EC%8A%B9&key_locale=in(Cho, Yongseung) 2010-11-04 The 14th International Workshop on Differential Geometry - Homogeneity of an equifocal submanifold and a proper complex equifocal submanifold I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4503&ko_name=Naoyuki+Koike&paper_id=(Naoyuki Koike) 2010-11-04 The 14th International Workshop on Differential Geometry - Hypersurfaces in Symmetric spaces I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4380&ko_name=Jurgen+Berndt&paper_id=(Jurgen Berndt) 2010-11-04 The 14th International Workshop on Differential Geometry - Geometry of Lagrangian submanifolds and isoparametric hypersurfaces I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4502&ko_name=Yoshihiro+Ohnita&paper_id=(Yoshihiro Ohnita) 2010-11-04 2010 KAIST Math Colloquium - Introduction to Random Matrix Theory (Lee, Jioon) 2010-10-28 Differential Geometry Seminar - The Geography Problems of 4-Manifolds, Part II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=612&ko_name=%EB%B0%95%EC%A2%85%EC%9D%BC&paper_id=&key_name=%EB%B0%95%EC%A2%85%EC%9D%BC&key_locale=in(Park, Jongil) 2010-10-28 Basic Notions Seminar - The Geography Problems of 4-Manifolds, Part I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=612&ko_name=%EB%B0%95%EC%A2%85%EC%9D%BC&paper_id=&key_name=%EB%B0%95%EC%A2%85%EC%9D%BC&key_locale=in(Park, Jongil) 2010-10-28 ASARC Seminar - Results on geometric flow (Pak Tung Ho) 2010-10-26 KAIST Discrete Math Seminar - On the free arrangements and truncated affine Weyl arrangements http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4663&ko_name=Masahiko+Yoshinaga&paper_id=(Masahiko Yoshinaga) 2010-10-26 KAIST Discrete Math Seminar - Approximation algorithms for finding maximum stable matchings http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4495&ko_name=Shuichi+Miyazaki&paper_id=(Shuichi Miyazaki) 2010-10-15 - Reactions at the Fe2O3(s)/H2O interface. - 1 (Prof. Brian Dempsey) 2010-10-15 - Reactions at the Fe2O3(s)/H2O interface. - 2 (Prof. Brian Dempsey) 2010-10-15 2010 KAIST Math Colloquium - Pairing http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1469&ko_name=%EC%9D%B4%ED%96%A5%EC%88%99&paper_id=&key_name=%EC%9D%B4%ED%96%A5%EC%88%99&key_locale=in(Lee, Hyangsook) 201010-14 Differential Geometry Seminar - Sub-conformal and almost CR geometry (Joo, Jaecheon) 2010-10-13 Differential Geometry Seminar - Degenerate Monge-Ampere equations and their applications http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4664&ko_name=Philippe+Eyssidieux&paper_id=(Philippe Eyssidieux) 2010-10-08 Face the world with mathematical mind - : , , (Hong, Seongwook) 2010-10-08 Basic Notions Seminar - An invitation to Kahler-Einstein metrics and Monge-Ampere equations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4664&ko_name=Philippe+Eyssidieux&paper_id=(Philippe Eyssidieux) 2010-10-08 2010 KAIST Math Colloquium - Weil-etale cohomology and special values of zeta-functions http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4496&ko_name=Thomas+Geisser&paper_id=(Thomas Geisser) 2010-10-07 ASARC Seminar - Finite generation questions for motivic cohomology http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4496&ko_name=Thomas+Geisser&paper_id=(Thomas Geisser) 2010-10-05 The Mathematics of Aperiodic Order - On Fibonacci electrons and the stability of soft quasicrystals (Ron Lifshitz) 2010-10-01 The Mathematics of Aperiodic Order - Aperiodic order and quantum mechanics http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4497&ko_name=David+Damanik&paper_id=(David Damanik) 2010-10-01 The Mathematics of Aperiodic Order - Rauzy fractals associated with a sequence of substitutions http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4499&ko_name=Pierre+Arnoux&paper_id=(Pierre Arnoux) 2010-09-30 The Mathematics of Aperiodic Order - Toward S-adic Rauzy fractals http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4501&ko_name=Valerie+Berthe&paper_id=(Valerie Berthe) 2010-09-30 MiniWorkshop on holomorphic symplectic geometry - Classification and construction of general singular fibers of proper Lagrangian fibration. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4668&ko_name=Keiji+Oguiso&paper_id=(Keiji Oguiso) 2010-09-30 The Mathematics of Aperiodic Order - Tilings associated with shift radix systems http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4666&ko_name=Wolfgang+Steiner&paper_id=(Wolfgang Steiner) 2010-09-30 MiniWorkshop on holomorphic symplectic geometry - An explicit study of non-locallytree locus of O'Grady's example (Yasunari Nagai) 2010-09-30 The Mathematics of Aperiodic Order - Number systems and tilings with p-adic factors http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4500&ko_name=J%C3%B6rg+M.+Thuswaldner&paper_id=(Joerg Thuswaldner) 2010-09-30 MiniWorkshop on holomorphic symplectic geometry - Global Torelli theorem for hyperkaehler manifolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4498&ko_name=Misha+Verbitsky&paper_id=(Misha Verbitsky) 2010-09-30 The Mathematics of Aperiodic Order - Discrete planes, two dimensional placement rules and connectivity of Rauzy fractals http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4665&ko_name=Anne+Siegel&paper_id=(Anne Siegel) 2010-09-30 MiniWorkshop on holomorphic symplectic geometry - Lagrangian fibrations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4667&ko_name=Dimitri+Markushevich&paper_id=(Dimitri Markushevich) 2010-09-30 The Mathematics of Aperiodic Order - Relative Cohomology for Tiling Spaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4493&ko_name=Lorenzo+Sadun&paper_id=(Lorenzo Sadun) 2010-09-30 MiniWorkshop on holomorphic symplectic geometry - Slodowy slices, Poisson deformations and symplectic hypersurfaces. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4672&ko_name=Manfred+Lehn&paper_id=(Manfred Lehn) 2010-09-29 MiniWorkshop on holomorphic symplectic geometry - Universal Poisson deformations and birational geometry http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4671&ko_name=Yukihiko+Namikawa&paper_id=(Yukihiko Namikawa) 2010-09-29 The Mathematics of Aperiodic Order - Words, decomposition rules and invariants http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4669&ko_name=Jun+Morita&paper_id=(Jun Morita) 2010-09-29 MiniWorkshop on holomorphic symplectic geometry - Minimal singularities in nilpotent orbits and a conjecture of Lusztig http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4670&ko_name=Baohua+Fu&paper_id=(Baohua Fu) 2010-09-29 MiniWorkshop on holomorphic symplectic geometry - Symplectic resolutions and canonical bases http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4345&ko_name=Dmitry+Kaledin&paper_id=(Dmitry Kaledin) 2010-09-29 The Mathematics of Aperiodic Order - Some comments on a hexagonal monotile http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4492&ko_name=Uwe+Grimm&paper_id=(Uwe Grimm) 2010-09-28 The Mathematics of Aperiodic Order - Fusion tilings (Natalie Priebe Frank) 2010-09-28 The Mathematics of Aperiodic Order - Topological invariants of aperiodic tilings (Franz Gahler) 2010-09-28 The Mathematics of Aperiodic Order - Arithmetics of self-similarities of Finitely Generated Uniformly Discrete http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4491&ko_name=Jean-Louis+Verger-Ga&paper_id=(Jean-Louis Verger-Gaugry) 2010-09-28 The Mathematics of Aperiodic Order - Aperiodic structures and notions of order and disorder (Shelomo I. Ben-Abraham) 2010-09-27 The Mathematics of Aperiodic Order - Wannier transform for aperiodic solids: preliminary results http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2909&ko_name=Jean+Bellissard&paper_id=(Jean Bellissard) 2010-09-27 KAIST Discrete Math Seminar - List coloring for geometric hypergraphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4489&ko_name=Shakhar+Smorodinsky&paper_id=(Shakhar Smorodinsky) 2010-09-17 - Geometry and Kinematics of the Fold-Thrust Belt and Structural Evolution of the Major Himalayan Fault zones in the Darjeeling - Sikkim Himalaya, India. (Kathakali Bhattacharyya) 2010-09-17 2010 KAIST Math Colloquium - Conflict-Free colorings http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4489&ko_name=Shakhar+Smorodinsky&paper_id=(Shakhar Smorodinsky) 2010-09-16 ASARC Seminar - A Quantum Kirwan Map and Symplectic Vortices (Fabian Ziltener) 2010-09-15 ASARC Seminar - Estimates of the topological entropy from below for continuous self-maps on some compact manifolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4505&ko_name=Waclaw+Marzantowicz&paper_id=(Waclaw Marzantowicz) 2010-09-10 2010 KAIST Math Colloquium - Brauer-Manin obstruction and integral points http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4488&ko_name=Jean-Louis+Colliot-T&paper_id=(Jean-Louis Colliot-Thelene) 2010-09-09 2010 KAIST Math Colloquium - Solitons in nonlinear dispersive equations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4278&ko_name=%EA%B6%8C%EC%88%9C%EC%8B%9D&paper_id=&key_name=%EA%B6%8C%EC%88%9C%EC%8B%9D&key_locale=in(Kwon, Soonsik) 2010-09-02 ASARC Seminar - Recent progress on algebraic cycles http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4745&ko_name=Masanori+Asakura&paper_id=(Masanori Asakura) 2010-08-31 2010 International Workshop on Mathematical Cryptology - HCI Security: 1. Human Knowledge-Based Authentication (Kwon, Taekyoung) 2010-08-28 2010 International Workshop on Mathematical Cryptology - Traffic measurement with virtual vector and anomaly detection (Yoon, MyungKeun) 2010-08-28 2010 International Workshop on Mathematical Cryptology - Order Preserving Symmetric Encryption (Lee, Younho) 2010-08-28 2010 International Workshop on Mathematical Cryptology - Pairing-based Non-interactive Zero-Knowledge Proofs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4673&ko_name=Jens+Groth&paper_id=(Jens Groth) 2010-08-28 2010 International Workshop on Mathematical Cryptology - Effcient Verifiably Encrypted Signatures Without Random Oracles (Lee, Juhee) 2010-08-28 2010 International Workshop on Mathematical Cryptology - Practical and Robust Multi-Party Private Set Intersection (Seo, Jaehong) 2010-08-28 2010 International Workshop on Mathematical Cryptology - Sharing Sensitive Information with Privacy (Gene Tsudik) 2010-08-28 2010 International Workshop on Mathematical Cryptology - On the Generic Group Model in Pairing-Based Cryptography http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4487&ko_name=Hovav+Shacham&paper_id=(Hovav Shacham) 2010-08-27 2010 International Workshop on Mathematical Cryptology - A New Approach on Pairings and Functional Encryption (Tatsuaki Okamoto) 2010-08-27 2010 International Workshop on Mathematical Cryptology - A Provable-Security Treatment of Symmetric Encryption http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4486&ko_name=Phillip+Rogaway&paper_id=(Phillip Rogaway) 2010-08-27 Lecture series on L2-invariants of knots and manifolds - L2-signatures and homology cobordism of 3-manifolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3904&ko_name=%EC%B0%A8%EC%9E%AC%EC%B6%98&paper_id=&key_name=%EC%B0%A8%EC%9E%AC%EC%B6%98&key_locale=in(Cha, Jaechoon) 2010-08-13 Lecture series on L2-invariants of knots and manifolds - Homological L2-invariants of knots and manifolds III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3904&ko_name=%EC%B0%A8%EC%9E%AC%EC%B6%98&paper_id=&key_name=%EC%B0%A8%EC%9E%AC%EC%B6%98&key_locale=in(Cha, Jaechoon) 2010-08-13 Lecture series on L2-invariants of knots and manifolds - Alexander polynomial, L2-signatures, and concordance on knots http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3730&ko_name=%EA%B9%80%ED%83%9C%ED%9D%AC&paper_id=&key_name=%EA%B9%80%ED%83%9C%ED%9D%AC&key_locale=in(Kim, Taehee) 2010-08-12 Lecture series on L2-invariants of knots and manifolds - Homological L2-invariants of knots and manifolds II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3904&ko_name=%EC%B0%A8%EC%9E%AC%EC%B6%98&paper_id=&key_name=%EC%B0%A8%EC%9E%AC%EC%B6%98&key_locale=in(Cha, Jaechoon) 2010-08-12 Lecture series on L2-invariants of knots and manifolds - Splitting properties of knot concordance invariants http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=90&ko_name=%EA%B9%80%EC%84%B8%EA%B5%AC&paper_id=&key_name=%EA%B9%80%EC%84%B8%EA%B5%AC&key_locale=in(Kim Segoo) 2010-08-11 Lecture series on L2-invariants of knots and manifolds - Homological L2-invariants of knots and manifolds I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3904&ko_name=%EC%B0%A8%EC%9E%AC%EC%B6%98&paper_id=&key_name=%EC%B0%A8%EC%9E%AC%EC%B6%98&key_locale=in(Cha, Jaechoon) 2010-08-11 Moduli and Birational Geometry - Quasi-admissible hyperelliptic covers with A and D singularities (Maksym Fedorchuk) 2010-08-08 Moduli and Birational Geometry - Compactified moduli spaces of curves in projective varieties. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4231&ko_name=%EA%B9%80%EC%98%81%ED%9B%88&paper_id=&key_name=%EA%B9%80%EC%98%81%ED%9B%88&key_locale=in(Kiem, Younghoon) 2010-08-08 Moduli and Birational Geometry - On geometric interpretation of other toroidal compactifications of the moduli of abelian varieties http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4288&ko_name=Valery+Alexeev&paper_id=(Valery Alexeev) 2010-08-08 Moduli and Birational Geometry - Computing alpha-invariants of Tian. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4476&ko_name=Ivan+Cheltsov&paper_id=(Ivan Cheltsov) 2010-08-07 Moduli and Birational Geometry - Fano 3-folds and finite subgroups of the Cremona group of rank 3. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4477&ko_name=Yuri+Vasilevich+Prok&paper_id=(Yuri Prokhorov) 2010-08-07 KAIST Discrete Math Seminar - Quasi-randomness of graph properties (Lee, Choongbum) 2010-08-06 Moduli and Birational Geometry - Exceptional and semi-exceptional quotient singularities. (Constantin Shramov) 2010-08-06 Moduli and Birational Geometry - On multiplier ideal sheaves and test configurations on toric Fano manifolds (Yuji Sano) 2010-08-06 Moduli and Birational Geometry - Hypertrees and moduli spaces of stable rational curves (Ana-Maria Castravet) 2010-08-06 Moduli and Birational Geometry - The birational classification of the universal Jacobian. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4291&ko_name=Gavril+Farkas&paper_id=(Gavril Farkas) 2010-08-06 Moduli and Birational Geometry - Vector bundles of conformal blocks on $\bar M\_{0,n}$ for sln, level 1 (David Swinarski) 2010-08-05 Moduli and Birational Geometry - Detaching embedded points (Dawei Chen) 2010-08-05 Moduli and Birational Geometry - Conformal Blocks Divisors on M0,n from sl2 (Angela Gibney) 2010-08-05 Moduli and Birational Geometry - Three dimensional Q-conic bundles and related topics. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4475&ko_name=Shigefumi+Mori&paper_id=(Shigefumi Mori) 2010-08-05 3 Topology Workshop - Real Bott manifolds and acyclic digraphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4471&ko_name=%EC%B5%9C%EC%88%98%EC%98%81&paper_id=&key_name=%EC%B5%9C%EC%88%98%EC%98%81&key_locale=in(Choi, Suyoung) 2010-08-04 3 Topology Workshop - Quantum homotopy theory II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3921&ko_name=%EB%B0%95%EC%9E%AC%EC%84%9D&paper_id=&key_name=%EB%B0%95%EC%9E%AC%EC%84%9D&key_locale=in(Park, Jaesuk) 2010-0804 2010 Summer Workshop for Young Mathematicians in Korea - Introduction to finite element method (Jin, Sangwon) 2010-08-04 3 Topology Workshop - Quantum homotopy theory I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3921&ko_name=%EB%B0%95%EC%9E%AC%EC%84%9D&paper_id=&key_name=%EB%B0%95%EC%9E%AC%EC%84%9D&key_locale=in(Park, Jaesuk) 2010-08-04 2010 Summer Workshop for Young Mathematicians in Korea - Introduction to Knot theory (Kim, Minhoon) 2010-08-04 3 Topology Workshop - An Introduction to ASD instantons and holomorphic Structures. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=731&ko_name=%EB%B3%80%EC%96%91%ED%98%84&paper_id=&key_name=%EB%B3%80%EC%96%91%ED%98%84&key_locale=in(Byun, Yanghyun) 2010-08-04 3 Topology Workshop - Introduction to the theory of bounded cohomology (Park, Heesook) 2010-08-04 2010 Summer Workshop for Young Mathematicians in Korea - Intoduction to moduli spaces (Moon, Hanbom) 2010-08-04 3 Topology Workshop - Homotopy theoretic view point of based loop space and free loop space. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=1891&ko_name=%EC%B5%9C%EC%98%81%EA%B8%B0&paper_id=&key_name=%EC%B5%9C%EC%98%81%EA%B8%B0&key_locale=in(Choi, Younggi) 2010-08-04 2010 Summer Workshop for Young Mathematicians in Korea - Stochastic calculus, application of real analysis in finance (Lee, Seungkyu) 2010-08-04 3 Topology Workshop - Yokota theory on ideal triangulation and volume of hyperbolic knot. (Kim, Sunhwa) 2010-08-04 3 Topology Workshop - Maurer-Cartan equation (Kim, Donghui) 2010-08-04 3 Topology Workshop - Three-fold branched covering spaces over a disk (Kim, Byungchun) 2010-08-04 3 Topology Workshop - Non-positively curved groups I,II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4058&ko_name=%EA%B9%80%EC%83%81%ED%98%84&paper_id=&key_name=%EA%B9%80%EC%83%81%ED%98%84&key_locale=in(Kim, Sanghyun) 201008-03 3 Topology Workshop - Lefschetz fibration and symplectic 4-manifolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3815&ko_name=%EC%9C%A4%EA%B8%B0%ED%97%8C&paper_id=&key_name=%EC%9C%A4%EA%B8%B0%ED%97%8C&key_locale=in(Yun, Kiheon) 2010-08-03 3 Topology Workshop - Orbibundle and Multisection http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4232&ko_name=%EC%A1%B0%EC%B2%A0%ED%98%84&paper_id=&key_name=%EC%A1%B0%EC%B2%A0%ED%98%84&key_locale=in(Cho, Cheolhyun) 201008-03 3 Topology Workshop - Homological vector fields and algebraic structures http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4232&ko_name=%EC%A1%B0%EC%B2%A0%ED%98%84&paper_id=&key_name=%EC%A1%B0%EC%B2%A0%ED%98%84&key_locale=in(Cho, Cheolhyun) 2010-08-03 2010 Summer Workshop for Young Mathematicians in Korea - Iwasawa theory for elliptic curves (Kim, Dohyung) 2010-08-03 2010 Summer Workshop for Young Mathematicians in Korea - Model theory and o-minimal structures (Lee, Junguk) 2010-08-03 2010 Summer Workshop for Young Mathematicians in Korea - Introduction to affine processes and its applications to mathematical finance (Kang, Chulmin) 2010-08-02 2010 Summer Workshop for Young Mathematicians in Korea - Fourier restriction conjecture and its interplay with geometric measure theory : the Kakeya conjecture (Bae, Joonsik) 2010-08-02 2010 Summer Workshop for Young Mathematicians in Korea - Contemporary cryptography introduction (Kim, Myungsun) 2010-08-02 KAIST Discrete Math Seminar - The uplift principle and the Riordan group (Lou Shapiro) 2010-07-23 The 5th KIAS Workshop on Differential Geometry - Density of a minimal submanifold and total curvature of its boundary http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=1918&ko_name=%EC%B5%9C%EC%9E%AC%EA%B2%BD&paper_id=&key_name=%EC%B5%9C%EC%9E%AC%EA%B2%BD&key_locale=in(Choe, Jaigyoung) 2010-07-20 The 5th KIAS Workshop on Differential Geometry - Capillary minimal annuli (Pyo, Juncheol) 2010-07-20 The 5th KIAS Workshop on Differential Geometry - On a family of complete embedded minimal surfaces in $R^\3$ with innitely many horizontal planar ends (Filippo Morabito) 2010-07-20 The 5th KIAS Workshop on Differential Geometry - The geometry of constant mean curvature surfaces embedded in $R^\3$ (Giuseppe Tinaglia) 2010-07-20 The 5th KIAS Workshop on Differential Geometry - Rigidity of complete minimal submanifolds in hyperbolic space http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3948&ko_name=%EC%84%9C%EA%B2%80%EA%B5%90&paper_id=&key_name=%EC%84%9C%EA%B2%80%EA%B5%90&key_locale=in(Seo, Keomkyo) 2010-07-19 The 5th KIAS Workshop on Differential Geometry - Kapouleas-Yang minimal surfaces in $S^\3$ and beyond http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4466&ko_name=Marc+Soret&paper_id=(Marc Soret) 2010-07-19 The 5th KIAS Workshop on Differential Geometry - On minimal surfaces bounded by a piecewise geodesic Jordan curve with 5 vertices (Min, Sunghong) 2010-07-19 The 5th KIAS Workshop on Differential Geometry - Half-space theorems in homogeneous manifolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4372&ko_name=Benoit+Daniel&paper_id=(Benoit Daniel) 2010-07-19 The 5th KIAS Workshop on Differential Geometry - Minimal annuli touching spheres (Park, Sungho) 2010-07-17 The 5th KIAS Workshop on Differential Geometry - Constant mean curvature surfaces in homogeneous 3-manifolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4506&ko_name=William+Meeks&paper_id=(William Meeks) 2010-07-17 BK21 Seminar - Free boundary problem and applications (Bae, Myoungjean) 2010-07-13 KAIST Discrete Math Seminar - Milnor numbers of projective hypersurfaces and the chromatic polynomial of graphs (Huh, June) 2010-07-09 2010 POSTECH Distinguished Professor Intensive Lecture Series - Symplectic topology and Hamiltonian dynamics 11 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2340&ko_name=%EC%98%A4%EC%9A%A9%EA%B7%BC&paper_id=&key_name=%EC%98%A4%EC%9A%A9%EA%B7%BC&key_locale=in(Oh, Yonggeun) 2010-07-08 KAIST-FUDAN 2010 Joint Workshop in Applied Mathematics - Fair and Optimal Power Allocation in a Two-hop Relay Network for QoS Support http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3816&ko_name=%ED%99%A9%EA%B0%95%EC%9A%B1&paper_id=&key_name=%ED%99%A9%EA%B0%95%EC%9A%B1&key_locale=in(Hwang, Ganguk) 2010-07-06 KAIST-FUDAN 2010 Joint Workshop in Applied Mathematics - MQ-quasi Interpolation for Estimating High Order Derivatives http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4674&ko_name=Wu+Zong+Min&paper_id=(Wu, Zongmin) 2010-07-06 KAIST-FUDAN 2010 Joint Workshop in Applied Mathematics - Pattern Classification Based on the Estimation of Class Probabilities (Rhee, Mankil) 2010-07-06 2010 POSTECH Distinguished Professor Intensive Lecture Series - Symplectic topology and Hamiltonian dynamics 10 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2340&ko_name=%EC%98%A4%EC%9A%A9%EA%B7%BC&paper_id=&key_name=%EC%98%A4%EC%9A%A9%EA%B7%BC&key_locale=in(Oh, Yonggeun) 2010-07-06 KAIST-FUDAN 2010 Joint Workshop in Applied Mathematics - Information, Hedging and Informed Traders http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4227&ko_name=%EA%B0%95%EC%99%84%EB%AA%A8&paper_id=&key_name=%EA%B0%95%EC%99%84%EB%AA%A8&key_locale=in(Kang, Wanmo) 2010-07-06 KAIST-FUDAN 2010 Joint Workshop in Applied Mathematics - Adaptive Identification of Time Delays in Nonlinear Dynamical Models (Lin Wei) 2010-07-06 KAIST-FUDAN 2010 Joint Workshop in Applied Mathematics - Beyond Shannon's Sampling theorem (Kwon, Kilhyun) 2010-07-06 KAIST-FUDAN 2010 Joint Workshop in Applied Mathematics - Global Existence of Critical Nonlinear Wave Equation with Time Dependent Variable Coecients (Zhou Yi) 2010-07-06 KAIST-FUDAN 2010 Joint Workshop in Applied Mathematics - A Generalization of Oleinik Type Inequalities and Intermediate Asymptotics in Nonlinear Diffusive Equations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4112&ko_name=%EA%B9%80%EC%9A%A9%EC%A0%95&paper_id=&key_locale=in(Kim, Yongjung) 2010-07-06 KAIST-FUDAN 2010 Joint Workshop in Applied Mathematics - Convergence to Equilibrium for Parabolic-Hyperbolic Time-Dependent Ginzburg-Landau-Maxwell Equations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4465&ko_name=Hao+Wu&paper_id=(Hao Wu) 2010-07-06 KAIST-FUDAN 2010 Joint Workshop in Applied Mathematics - Optimal Convergence Analysis of an Immersed Interface Finite Element Method http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2203&ko_name=%EA%B3%BD%EB%8F%84%EC%98%81&paper_id=&key_locale=in(Kwak, Doyoung) 2010-07-06 KAIST-FUDAN 2010 Joint Workshop in Applied Mathematics - Super-Large Sparse Matrix Computations in Web Information Retrieval http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4464&ko_name=Yimin+Wei&paper_id=(Yimin Wei) 2010-07-05 KAIST-FUDAN 2010 Joint Workshop in Applied Mathematics - Recovery of Fine Shape Details Using the Generalized Polarization Tensors (Lim, Mikyoung) 2010-07-05 KAIST-FUDAN 2010 Joint Workshop in Applied Mathematics - Stabilizing Effect of Convection in Incompressible Flows http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4675&ko_name=Zhen+Lei&paper_id=(Zhen Lei) 2010-07-05 BK21 Seminar - Transonic Shocks and Free Boundary Problems (Bae, Myoungjean) 2010-07-02 2010 POSTECH Distinguished Professor Intensive Lecture Series - Symplectic topology and Hamiltonian dynamics 9 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2340&ko_name=%EC%98%A4%EC%9A%A9%EA%B7%BC&paper_id=&key_name=%EC%98%A4%EC%9A%A9%EA%B7%BC&key_locale=in(Oh, Yonggeun) 2010-07-01 2010 ALGEBRAIC GEOMETRY WORKSHOP - On the gonality and Clifford index of algebraic curves (Choi, Youngwook) 2010-06-30 2010 ALGEBRAIC GEOMETRY WORKSHOP - Multisecant, higher order normalities, and inner projections 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5089&ko_name=%ED%95%9C%EA%B0%95%EC%A7%84&paper_id=&key_name=%ED%95%9C%EA%B0%95%EC%A7%84&key_pos=%ED%95%9C%EA%B5%AD%EA%B3%A0%EB%93%B1%EA%B3%BC%ED%9(Han, Kangjin) 2010-06-30 2010 ALGEBRAIC GEOMETRY WORKSHOP - Multisecant, higher order normalities, and inner projections 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=5089&ko_name=%ED%95%9C%EA%B0%95%EC%A7%84&paper_id=&key_name=%ED%95%9C%EA%B0%95%EC%A7%84&key_pos=%ED%95%9C%EA%B5%AD%EA%B3%A0%EB%93%B1%EA%B3%BC%ED%9(Han, Kangjin) 2010-06-30 2010 POSTECH Distinguished Professor Intensive Lecture Series - Symplectic topology and Hamiltonian dynamics 8 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2340&ko_name=%EC%98%A4%EC%9A%A9%EA%B7%BC&paper_id=&key_name=%EC%98%A4%EC%9A%A9%EA%B7%BC&key_locale=in(Oh, Yonggeun) 2010-06-29 2010 ALGEBRAIC GEOMETRY WORKSHOP - Non-arithmetically Cohen-Macaulay divisors on a rational normal scroll http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3952&ko_name=%EB%B0%95%EC%9D%98%EC%84%B1&paper_id=&key_name=%EB%B0%95%EC%9D%98%EC%84%B1&key_locale=in(Park, Euisung) 2010-06-29 2010 ALGEBRAIC GEOMETRY WORKSHOP - On the minimal free resolution of projected algebraic curves (Lee, Wanseok) 2010-06-29 2010 ALGEBRAIC GEOMETRY WORKSHOP - Q-homology projective plane (Hwang, Dongsun) 2010-06-29 2010 ALGEBRAIC GEOMETRY WORKSHOP - The degree complexity via generic initial ideals (Song Youngseok) 2010-06-28 2010 ALGEBRAIC GEOMETRY WORKSHOP - Secants to the variety of completely reducible forms (Ahn, Jeaman) 2010-06-28 2010 ALGEBRAIC GEOMETRY WORKSHOP - The geometry of Grobner bases (Ahn, Jeaman) 2010-06-28 International workshop on differential geometry - Eta-Einstein tangent sphere bundles http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=599&ko_name=%EB%B0%95%EC%A0%95%ED%98%95&paper_id=&key_name=%EB%B0%95%EC%A0%95%ED%98%95&key_locale=in(Park, Jeonghyeong) 2010-06-25 International workshop on differential geometry - Positively curved Finsler manifolds with symmetry (Kim, Changwan) 2010-06-25 International workshop on differential geometry - Hodge metric and its pseudohermitian lift (Sung, Chanyoung) 2010-06-25 International workshop on differential geometry - Contact 3-manifolds and Ricci solitons http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=1780&ko_name=%EC%A1%B0%EC%A2%85%ED%83%9D&paper_id=&key_name=%EC%A1%B0%EC%A2%85%ED%83%9D&key_locale=in(Cho, Jongtaek) 2010-06-25 International workshop on differential geometry - On Sasaki Einstein metrics http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=30&ko_name=%EA%B9%80%EB%B3%91%ED%95%99&paper_id=&key_name=%EA%B9%80%EB%B3%91%ED%95%99&key_locale=in(Kim, Byunghak) 2010-06-25 International workshop on differential geometry - Contact metrics with negative scalar curvature (Kim, Jongsu) 2010-06-25 International workshop on differential geometry - A curvature identity on a 4-dimensional Riemannian manifold http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4463&ko_name=Kouei+sekigawa&paper_id=(Kouei Sekigawa) 2010-06-25 International workshop on differential geometry - Area- minimizing vector fields on the two-dimensional sphere http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4461&ko_name=Olga+Gil-Medrano&paper_id=(Olga Gil-Medrano) 2010-06-25 International workshop on differential geometry - On curvature homogeneous spaces and their modifications http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4462&ko_name=Oldrich+Kowalski&paper_id=(Oldrich Kowalski) 2010-06-25 2010 POSTECH Distinguished Professor Intensive Lecture Series - Symplectic topology and Hamiltonian dynamics 7 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2340&ko_name=%EC%98%A4%EC%9A%A9%EA%B7%BC&paper_id=&key_name=%EC%98%A4%EC%9A%A9%EA%B7%BC&key_locale=in(Oh, Yonggeun) 2010-06-24 Lectures on Spectral invariants and Moduli spaces - Lectures on Spectral invariants and Moduli spaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4448&ko_name=Sergiu+Moroianu&paper_id=(Sergiu Moroianu) 2010-06-23 Lectures on Spectral invariants and Moduli spaces - Lectures on Spectral invariants and Moduli spaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4448&ko_name=Sergiu+Moroianu&paper_id=(Sergiu Moroianu) 2010-06-23 2010 POSTECH Distinguished Professor Intensive Lecture Series - Symplectic topology and Hamiltonian dynamics 6 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2340&ko_name=%EC%98%A4%EC%9A%A9%EA%B7%BC&paper_id=&key_name=%EC%98%A4%EC%9A%A9%EA%B7%BC&key_locale=in(Oh, Yonggeun) 2010-06-22 Lectures on Spectral invariants and Moduli spaces - Arithmatic Riemann-Roch of Geometry of Riemann surfaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4450&ko_name=Lin+Weng&paper_id=(Lin Weng) 2010-06-22 Lectures on Spectral invariants and Moduli spaces - Lectures on Spectral invariants and Moduli spaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4446&ko_name=Dmitri+Korotkin&paper_id=(Dmitri Korotkin) 2010-06-22 Lectures on Spectral invariants and Moduli spaces - Recent developments in the Takhtajan-Zograf metric 1,2 (Kunio Obitsu) 2010-06-21 2010 The 7th KWMS International Conference - Groups, Leech Lattice and K3 Surfaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2259&ko_name=%EA%B8%88%EC%A2%85%ED%95%B4&paper_id=&key_name=%EA%B8%88%EC%A2%85%ED%95%B4&key_locale=in(Keum, Jonghae) 2010-06-21 2010 The 7th KWMS International Conference - Minimal vector fields on Riemannian manifolds http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4461&ko_name=Olga+Gil-Medrano&paper_id=(Olga Gil-Medrano) 2010-06-21 Lectures on Spectral invariants and Moduli spaces - Lectures on Spectral invariants and Moduli spaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4446&ko_name=Dmitri+Korotkin&paper_id=(Dmitri Korotkin) 2010-06-21 Lectures on Spectral invariants and Moduli spaces - Geometry of CY moduli (2) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4447&ko_name=Zhiqin+Lu&paper_id=(Zhiqin Lu) 2010-06-19 Lectures on Spectral invariants and Moduli spaces - Lectures on Spectral invariants and Moduli spaces (Frederic Rochon) 2010-06-19 Lectures on Spectral invariants and Moduli spaces - Geometry of CY moduli (1) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4447&ko_name=Zhiqin+Lu&paper_id=(Zhiqin Lu) 2010-06-18 Lectures on Spectral invariants and Moduli spaces - Lectures on Spectral invariants and Moduli spaces (Frederic Rochon) 2010-06-18 Lectures on Spectral invariants and Moduli spaces - Gonality and hyperbolic geometry of a compact Riemann surface 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4449&ko_name=Wing-Keung+To&paper_id=(Wing Keung) 2010-06-17 2010 POSTECH Distinguished Professor Intensive Lecture Series - Symplectic topology and Hamiltonian dynamics 5 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2340&ko_name=%EC%98%A4%EC%9A%A9%EA%B7%BC&paper_id=&key_name=%EC%98%A4%EC%9A%A9%EA%B7%BC&key_locale=in(Oh, Yonggeun) 2010-06-17 Lectures on Spectral invariants and Moduli spaces - Lectures on Spectral invariants and Moduli spaces (Andrew McIntyre) 2010-06-17 Lectures on Spectral invariants and Moduli spaces - Lectures on Spectral invariants and Moduli spaces (Andrew McIntyre) 2010-06-17 Lectures on Spectral invariants and Moduli spaces - Gonality and hyperbolic geometry of a compact Riemann surface 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4449&ko_name=Wing-Keung+To&paper_id=(Wing Keung) 2010-06-17 2010 POSTECH Distinguished Professor Intensive Lecture Series - Symplectic topology and Hamiltonian dynamics 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2340&ko_name=%EC%98%A4%EC%9A%A9%EA%B7%BC&paper_id=&key_name=%EC%98%A4%EC%9A%A9%EA%B7%BC&key_locale=in(Oh, Yonggeun) 2010-06-15 - Structure and Convection in the deep interiors of the Earth and Super-Earth Exo-planets ( ) 2010-06-09 2010 POSTECH Distinguished Professor Intensive Lecture Series - Symplectic topology and Hamiltonian dynamics 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2340&ko_name=%EC%98%A4%EC%9A%A9%EA%B7%BC&paper_id=&key_name=%EC%98%A4%EC%9A%A9%EA%B7%BC&key_locale=in(Oh, Yonggeun) 2010-06-08 Industrial Mathematics Initiatives 2010 - Fetal growth: How big should your baby be? http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4444&ko_name=Graeme+Wake&paper_id=(Graeme Wake) 2010-06-05 Industrial Mathematics Initiatives 2010 - An Immersed Boundary Method for General Flow Applications (Choi, Jungil) 2010-06-05 Industrial Mathematics Initiatives 2010 - Exploding Rock http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4445&ko_name=Mark+McGuinness&paper_id=(Mark McGuinness) 2010-06-05 Industrial Mathematics Initiatives 2010 - Cooking Crispy Cereals and Modelling Submarine Batteries http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4445&ko_name=Mark+McGuinness&paper_id=(Mark McGuinness) 2010-06-04 Industrial Mathematics Initiatives 2010 - Least Squares Algorithms for Box-Constrained Image Deblurring http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=1447&ko_name=%EC%9D%B4%EC%B0%BD%EC%98%A5&paper_id=&key_name=%EC%9D%B4%EC%B0%BD%EC%98%A5&key_locale=in(Lee, Changock) 2010-06-04 Industrial Mathematics Initiatives 2010 - Graph and Brain (Hwang, Donguk) 2010-06-04 Industrial Mathematics Initiatives 2010 - The Pantograph Equation http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4418&ko_name=Bruce+Van-Brunt&paper_id=(Bruce van Brunt) 2010-06-04 Industrial Mathematics Initiatives 2010 - Homing Guidance Loop Design and its Analysis http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4112&ko_name=%EA%B9%80%EC%9A%A9%EC%A0%95&paper_id=&key_name=%EA%B9%80%EC%9A%A9%EC%A0%95&key_locale=in(Kim, Yongjung) 2010-06-04 Industrial Mathematics Initiatives 2010 - Image processing on some industrial problems http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4187&ko_name=%EA%B0%95%EB%AA%85%EC%A3%BC&paper_id=&key_name=%EA%B0%95%EB%AA%85%EC%A3%BC&key_locale=in(Kang, Myungjoo) 2010-06-04 Industrial Mathematics Initiatives 2010 - Uncertainty Quantification in Large-Eddy Simulation of Turbulent Flows (You, Donghyun) 2010-06-04 Industrial Mathematics Initiatives 2010 - Industrial Mathematics: On the crest of a wave http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4444&ko_name=Graeme+Wake&paper_id=(Graeme Wake) 2010-06-04 2010 POSTECH Distinguished Professor Intensive Lecture Series - Symplectic topology and Hamiltonian dynamics 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2340&ko_name=%EC%98%A4%EC%9A%A9%EA%B7%BC&paper_id=&key_name=%EC%98%A4%EC%9A%A9%EA%B7%BC&key_locale=in(Oh, Yonggeun) 2010-06-03 2010 POSTECH Distinguished Professor Intensive Lecture Series - Symplectic topology and Hamiltonian dynamics 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2340&ko_name=%EC%98%A4%EC%9A%A9%EA%B7%BC&paper_id=&key_name=%EC%98%A4%EC%9A%A9%EA%B7%BC&key_locale=in(Oh, Yonggeun) 2010-06-01 ASARC Seminar - Quasitoric orbifolds 1 (Mainak Poddar) 2010-05-27 ASARC Seminar - Quasitoric orbifolds 2 (Mainak Poddar) 2010-05-27 ASARC Seminar - Non-commutative topology and geometry: a geometry-algebra correspondence. (Lee, Hyunho) 2010-05-25 ASARC Seminar - Stringy topology of orbifolds 1 (Mainak Poddar) 2010-05-25 ASARC Seminar - Stringy topology of orbifolds 2 (Mainak Poddar) 2010-05-25 KAIST Discrete Math Seminar - Matroids on convex geometries http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4422&ko_name=Yoshio+Sano&paper_id=&key_name=sano&key_locale=in(Yoshio Sano) 2010-05-14 ASARC Seminar - Holomorphic Lagrangian fibrations. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4421&ko_name=Justin+Sawon&paper_id=(Justin Sawon) 2010-05-11 Face the world with mathematical mind - 2008 (Chae, Suchan) 2010-05-07 2010 KAIST Math Colloquium - Advanced Neuroimaging : brain connectomics (Park, Haejung) 2010-05-06 ASARC Seminar - Infinitesimal deformations of complements of plumbings. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=850&ko_name=%EC%8B%A0%EB%8F%99%EC%88%98&paper_id=&key_name=%EC%8B%A0%EB%8F%99%EC%88%98&key_locale=in(Shin, Dongsoo) 2010-05-04 From Einstein's equation to Cosmology - http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4419&ko_name=Joel+Smoller&paper_id=(Joel Smoller) 2010-05-03 KAIST-NIMS International Workshop on Nonlinear Partial Differential Equations: theory, application and numerical computation - Convergence of a semi-Lagrangian scheme for the Boltzmann-BGK model. (Yun, Seokbae) 2010-05-01 KAIST-NIMS International Workshop on Nonlinear Partial Differential Equations: theory, application and numerical computation - Isometric immersions and compensated compactness http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4317&ko_name=Marshall+Slemrod&paper_id=&key_name=slemrod&key_locale=in(Marshall Slemrod) 2010-05-01 KAIST-NIMS International Workshop on Nonlinear Partial Differential Equations: theory, application and numerical computation - Multiscale models for fluid mixing (Kim, Dongyung) 2010-05-01 KAIST-NIMS International Workshop on Nonlinear Partial Differential Equations: theory, application and numerical computation - Mass-critical generalized KdV equation. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4278&ko_name=%EA%B6%8C%EC%88%9C%EC%8B%9D&paper_id=&key_name=%EA%B6%8C%EC%88%9C%EC%8B%9D&key_locale=in(Kwon, Soonsik) 2010-04-30 KAIST-NIMS International Workshop on Nonlinear Partial Differential Equations: theory, application and numerical computation - Conservation Laws and Characteristics for Certain Classes of Evolution Equations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4418&ko_name=Bruce+VanBrunt&paper_id=(Bruce vanBrunt) 2010-04-30 KAIST-NIMS International Workshop on Nonlinear Partial Differential Equations: theory, application and numerical computation - Recent results in Vlasov theory http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4233&ko_name=%ED%99%A9%ED%98%95%EC%A3%BC&paper_id=&key_name=%ED%99%A9%ED%98%95%EC%A3%BC&key_locale=in(Hwang, Hyungju) 2010-04-30 KAIST-NIMS International Workshop on Nonlinear Partial Differential Equations: theory, application and numerical computation - Higher-order time asymptotics of fast diffusion in Euclidean space http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3220&ko_name=Robert+J.+McCann&paper_id=McCann(Robert McCann) 2010-04-30 KAIST-NIMS International Workshop on Nonlinear Partial Differential Equations: theory, application and numerical computation - From Cucker-Smale to Kuramoto http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3955&ko_name=%ED%95%98%EC%8A%B9%EC%97%B4&paper_id=&key_name=%ED%95%98%EC%8A%B9%EC%97%B4&key_locale=in(Ha, Suengyeal) 2010-04-30 KAIST-NIMS International Workshop on Nonlinear Partial Differential Equations: theory, application and numerical computation - Kinetic models in material science http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2490&ko_name=Athanasios+E.+Tzavar&paper_id=Tzavaras(Athanasios E. Tzavaras) 2010-04-30 KAIST-NIMS International Workshop on Nonlinear Partial Differential Equations: theory, application and numerical computation - Expanding Wave Solutions of the Einstein Equations That Induce an Anomalous Acceleration Into the Standard Model of Cosmology http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4419&ko_name=Joel+Smoller&paper_id=(Joel Smoller) 2010-04-30 2010 KAIST Math Colloquium - Historical development of algebraic number theory (Han, Rin) 2010-04-29 KAIST-NIMS International Workshop on Nonlinear Partial Differential Equations: theory, application and numerical computation - Regularity theory for the nonlocal equations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3937&ko_name=%EC%9D%B4%EA%B8%B0%EC%95%94&paper_id=&key_name=%EC%9D%B4%EA%B8%B0%EC%95%94&key_locale=in(Lee, Kiahm) 2010-04-29 2010 KAIST Math Colloquium - http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1918&ko_name=%EC%B5%9C%EC%9E%AC%EA%B2%BD&paper_id=&key_name=%EC%B5%9C%EC%9E%AC%EA%B2%BD&key_locale=in(Choe, Jaigyoung) 2010-0429 KAIST-NIMS International Workshop on Nonlinear Partial Differential Equations: theory, application and numerical computation - Global solutions for the multi-dimensional magnetohydrodynamics http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2613&ko_name=Dehua+Wang&paper_id=Wang(Dehua Wang) 2010-04-29 KAIST-NIMS International Workshop on Nonlinear Partial Differential Equations: theory, application and numerical computation - A unified generalization of the Oleinik and the Aronson-Benilan type estimates http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4112&ko_name=%EA%B9%80%EC%9A%A9%EC%A0%95&paper_id=&key_name=%EA%B9%80%EC%9A%A9%EC%A0%95&key_locale=in(Kim, Yongjung) 2010-04-29 KAIST-NIMS International Workshop on Nonlinear Partial Differential Equations: theory, application and numerical computation - Shock Reflection-Diffraction, Free Boundary Problems, and Nonlinear Conservation Laws of Mixed Type http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4513&ko_name=Gui-Qiang+G.+Chen&paper_id=(Gui-Qiang Chen) 2010-04-29 KAIST-NIMS International Workshop on Nonlinear Partial Differential Equations: theory, application and numerical computation - Global Regularity for the Three-dimensional Primitive Equations of Atmospheric and Oceanic Dynamics http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4420&ko_name=Edriss+Titi&paper_id=(Edriss Titi) 2010-04-29 KAIST-NIMS International Workshop on Nonlinear Partial Differential Equations: theory, application and numerical computation - A variational method for spike layer solutions to a singularly perturbed problem http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3679&ko_name=%EB%B3%80%EC%9E%AC%ED%98%95&paper_id=&key_name=%EB%B3%80%EC%9E%AC%ED%98%95&key_locale=in(Byeon, Jaeyoung) 2010-04-29 KAIST-NIMS International Workshop on Nonlinear Partial Differential Equations: theory, application and numerical computation - Hybrid solutions of a family of semilinear elliptic PDE's http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4417&ko_name=Paul+H.+Rabinowitz&paper_id=(Paul Rabinowitz) 2010-04-29 2010 KAIST Math Colloquium - ? (Kim, Jangsoo) 2010-04-26 KAIST Discrete Math Seminar - Combinatorics on permutation tableaux (Kim, Jangsoo) 2010-04-26 - Network coding for wireless networks (Lee, Heungno) 2010-04-23 ASARC Seminar - Young tableaux and crystals 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2120&ko_name=%EA%B0%95%EC%84%9D%EC%A7%84&paper_id=&key_name=%EA%B0%95%EC%84%9D%EC%A7%84&key_locale=in(Kang, Seokjin) 2010-04-23 - OpenFlow (Seok, Seungjoon) 2010-04-23 - Heterogeneous attachment strategies optimize the topology of dynamic wireless networks (Kim, Beomjun) 2010-04-23 - Resource allocation over network dynamics without timescale separation: A stochastic approximation based approach (Yi, Yung) 2010-04-23 - ID-based network coding signature schemes http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1842&ko_name=%EC%B2%9C%EC%A0%95%ED%9D%AC&paper_id=&key_name=%EC%B2%9C%EC%A0%95%ED%9D%AC&key_locale=in(Cheon, Junghee) 2010-04-23 - Throughput-optimal wireless scheduling with limited feedback: A Lyapunov technique for stability analysis (Kim, Yoora) 2010-04-23 - Route selection with routers of diverse capabilities (Chung, Yoochul) 2010-04-23 - (Lee, Euichul) 2010-04-23 - (Choi, Jinhyuk) 2010-04-23 - : key driver (Jeong, Sangjin) 2010-04-23 ASARC Seminar - Young tableaux and crystals 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2120&ko_name=%EA%B0%95%EC%84%9D%EC%A7%84&paper_id=&key_name=%EA%B0%95%EC%84%9D%EC%A7%84&key_locale=in(Kang, Seokjin) 2010-04-22 ASARC Seminar - Young tableaux and crystals 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2120&ko_name=%EA%B0%95%EC%84%9D%EC%A7%84&paper_id=&key_name=%EA%B0%95%EC%84%9D%EC%A7%84&key_locale=in(Kang, Seokjin) 2010-04-21 ASARC Seminar - Some construction of Calabi-Yau 3-folds and G_2 manifolds (Lee, Namhoon) 2010-04-19 - Spectroscopic analysis of arsenic mobilization during oxidation of mackinawite(FeS) ( ) 2010-04-16 2010 KAIST Math Colloquium - Viscosity Method on Homogenization http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3937&ko_name=%EC%9D%B4%EA%B8%B0%EC%95%94&paper_id=&key_name=%EC%9D%B4%EA%B8%B0%EC%95%94&key_locale=in(Lee, Kiahm) 2010-04-15 ASARC Seminar - The height of a Kummer surface of special type (Jang, Junmyeong) 2010-04-13 KAIST Discrete Math Seminar - A Combinatorial Formula for Information Flow in a Network http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4402&ko_name=%EA%B5%AD%EC%9B%85&paper_id=&key_locale=in(Kook, Woong) 2010-04-09 ASARC Seminar - Full flag Hilbert scheme of points on the family of nodal curves (Lee, Hwayoung) 2010-04-06 KAIST Discrete Math Seminar - On the Number of Spanning Trees, Orientations, and Cycles http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4407&ko_name=Carsten+Thomassen&paper_id=(Carsten Thomassen) 2010-04-02 - ( ) 2010-04-02 - Geology, Geoscience. The true fusion science ( ) 2010-04-02 2010 KAIST Math Colloquium - Rendezvous Numbers and von Neumann's min-max Theorem http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4407&ko_name=Carsten+Thomassen&paper_id=(Carsten Thomassen) 2010-04-01 ASARC Seminar - Rational homology projective planes and related problems. (Hwang, Dongseon) 2010-03-30 KAIST Discrete Math Seminar - Approximate Shortest Path and Distance Queries in Networks (Christian Sommer) 2010-03-26 Lectures on Algebraic Surfaces by Miles Reid (WCU project) - Lectures on Algebraic Surfaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2010-03-20 NIMS-KIAS Summer Winter School - Lecture 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4404&ko_name=Alan+Reid&paper_id=(Alan Reid) 2010-03-19 NIMS-KIAS Summer Winter School - Earthquakes and the universal Teichmueller space http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4405&ko_name=Hideki+Miyachi&paper_id=(Hideki Miyachi) 2010-03-19 NIMS-KIAS Summer Winter School - Realizing invariants (Walter Neumann) 2010-03-19 NIMS-KIAS Summer Winter School - Hyperbolic structures from angle structures http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4400&ko_name=Craig+Hodgson&paper_id=(Craig Hodgson) 2010-03-19 - Nano-scale hydrous ferric oxide(HFO) incorporated diatomite for permeable reactive barrier(PRB) application to remediate organic- and inorganic arsenic contaminated groundwater ( ) 2010-03-19 2010 KAIST Math Colloquium - Blow-up of Electric Fields between Closely Spaced Perfect Conductors http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4320&ko_name=%EC%9E%84%EB%AF%B8%EA%B2%BD&paper_id=&key_name=%EC%9E%84%EB%AF%B8%EA%B2%BD&key_locale=in(Lim, Mikyoung) 2010-03-18 NIMS-KIAS Summer Winter School - Lecture 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4404&ko_name=Alan+Reid&paper_id=(Alan Reid) 2010-03-18 NIMS-KIAS Summer Winter School - Bounds for minimal dilatations of pseudo-Anosovs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4408&ko_name=Mitsuhiko+Takasawa&paper_id=(Mitsuhiko Takasawa) 2010-03-18 NIMS-KIAS Summer Winter School - Homology-related invariants http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2624&ko_name=Walter+Neumann&paper_id=Neumann(Walter Neumann) 2010-03-18 NIMS-KIAS Summer Winter School - Computing hyperbolic structures and invariants http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4400&ko_name=Craig+Hodgson&paper_id=(Craig Hodgson) 2010-03-18 KAIST Discrete Math Seminar - Polytope numbers (Lee, Joonyop) 2010-03-17 NIMS-KIAS Summer Winter School - Lecture 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4404&ko_name=Alan+Reid&paper_id=(Alan Reid) 2010-03-17 NIMS-KIAS Summer Winter School - Deformation spaces of Kleinian groups: what we can see from geometric limits http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4409&ko_name=kenichi+Ohshika&paper_id=(Kenich Ohshika) 2010-03-17 NIMS-KIAS Summer Winter School - Basic arithmetic invariants and scissors congruence http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=2624&ko_name=Walter+Neumann&paper_id=Neumann(Walter Neumann) 2010-03-17 NIMS-KIAS Summer Winter School - Hyperbolic structures from ideal triangulations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4400&ko_name=Craig+Hodgson&paper_id=(Craig Hodgson) 2010-03-17 NIMS-KIAS Summer Winter School - a course in number theory 2 (Choi, Suhhyun) 2010-03-16 NIMS-KIAS Summer Winter School - Rigidity and arithmeticity http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3987&ko_name=%EA%B9%80%EC%9D%B8%EA%B0%95&paper_id=&key_name=%EA%B9%80%EC%9D%B8%EA%B0%95&key_locale=in(Kim, Inkang) 201003-16 NIMS-KIAS Summer Winter School - Preliminary lectures on Kleinian groups II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4409&ko_name=kenichi+Ohshika&paper_id=(Kenich Ohshika) 2010-03-16 NIMS-KIAS Summer Winter School - a course in number theory 1 (Choi, Suhhyun) 2010-03-16 NIMS-KIAS Summer Winter School - Introduction to orbifolds II: Geometry http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1878&ko_name=%EC%B5%9C%EC%84%9C%EC%98%81&paper_id=&key_name=%EC%B5%9C%EC%84%9C%EC%98%81&key_locale=in(Choi, Suhyoung) 2010-03-15 NIMS-KIAS Summer Winter School - Preliminary lectures on Kleinian groups http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4409&ko_name=kenichi+Ohshika&paper_id=(Kenich Ohshika) 2010-03-15 NIMS-KIAS Summer Winter School - A Course on orbifolds I : Topology http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=1878&ko_name=%EC%B5%9C%EC%84%9C%EC%98%81&paper_id=&key_name=%EC%B5%9C%EC%84%9C%EC%98%81&key_locale=in(Choi, Suhyoung) 2010-03-15 NIMS-KIAS Summer Winter School - A Course on geometry I : Intrduction http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=3987&ko_name=%EA%B9%80%EC%9D%B8%EA%B0%95&paper_id=&key_name=%EA%B9%80%EC%9D%B8%EA%B0%95&key_locale=in(Kim, Inkang) 2010-03-15 Lectures on Algebraic Surfaces by Miles Reid (WCU project) - Lectures on Algebraic Surfaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2010-03-13 - ( ) 2010-03-12 BK21 Seminar - NONREFLECTING BOUNDARY CONDITIONS FOR TIME-DEPENDENT WAVE PROPAGATION (Sim, Imbo) 2010-03-11 BK21 Seminar - Nonparametric Bayes Conditional Distribution Modeling with Variable Selection (Chung, Yeonseung) 2010-03-10 ASARC Seminar - Examples of (non) Stein domains and manifolds. (Dan Jaffran) 2010-03-09 BK21 Seminar - Asymptotic Behavior of Invariant Metrics (Lina Lee) 2010-03-09 2010 KAIST Math Colloquium - Introduction to Toric Topology http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=742&ko_name=%EC%84%9C%EB%8F%99%EC%97%BD&paper_id=&key_name=%EC%84%9C%EB%8F%99%EC%97%BD&key_locale=in(Suh, Dongyoup) 2010-03-04 KAIST Toric Topology Workshop 2010 - RR=#BS via localization of index 7 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4412&ko_name=Takahiko+Yoshida&paper_id=(Takahiko Yoshida) 2010-03-02 KAIST Toric Topology Workshop 2010 - RR=#BS via localization of index 6 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4412&ko_name=Takahiko+Yoshida&paper_id=(Takahiko Yoshida) 2010-02-26 KAIST Toric Topology Workshop 2010 - RR=#BS via localization of index 5 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4412&ko_name=Takahiko+Yoshida&paper_id=(Takahiko Yoshida) 2010-02-26 KAIST Toric Topology Workshop 2010 - RR=#BS via localization of index 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4412&ko_name=Takahiko+Yoshida&paper_id=(Takahiko Yoshida) 2010-02-26 KAIST Toric Topology Workshop 2010 - On the first homology of automorphism groups of G-manifolds 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4411&ko_name=Kojun+Abe&paper_id=(Kojun Abe) 2010-02-26 KAIST Toric Topology Workshop 2010 - On the first homology of automorphism groups of G-manifolds 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4411&ko_name=Kojun+Abe&paper_id=(Kojun Abe) 2010-02-26 KAIST Toric Topology Workshop 2010 - RR=#BS via localization of index 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4412&ko_name=Takahiko+Yoshida&paper_id=(Takahiko Yoshida) 2010-02-25 2010 KAIST Math Colloquium - Apollonian Circle Packings http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4410&ko_name=%EC%98%A4%ED%9D%AC&paper_id=&key_name=%EC%98%A4%ED%9D%AC&key_locale=in(Oh, Hee) 2010-02-25 KAIST Toric Topology Workshop 2010 - RR=#BS via localization of index 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4412&ko_name=Takahiko+Yoshida&paper_id=(Takahiko Yoshida) 2010-02-25 KAIST Toric Topology Workshop 2010 - On construction of locally standard Z2-torus actions on manifolds (Li Yu) 2010-02-25 KAIST Toric Topology Workshop 2010 - Schubert calculus, seen from torus equivariant topology 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4415&ko_name=Shizuo+Kaji&paper_id=(Shizuo Kaji) 2010-02-25 KAIST Toric Topology Workshop 2010 - Schubert calculus, seen from torus equivariant topology 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4415&ko_name=Shizuo+Kaji&paper_id=(Shizuo Kaji) 2010-02-25 BK21 Seminar - EigenValue Problem III (Shu Feng Xu) 2010-02-24 KAIST Toric Topology Workshop 2010 - Moment-angle manifolds in toric topology 4 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4425&ko_name=Taras+PANOV&paper_id=(Taras panov) 2010-02-24 KAIST Toric Topology Workshop 2010 - Moment-angle manifolds in toric topology 3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4425&ko_name=Taras+PANOV&paper_id=(Taras panov) 2010-02-24 KAIST Toric Topology Workshop 2010 - RR=#BS via localization of index 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4412&ko_name=Takahiko+Yoshida&paper_id=(Takahiko Yoshida) 2010-02-23 KAIST Toric Topology Workshop 2010 - Combinatorial rigidity of 3-dimensional simplicial polytopes http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4471&ko_name=%EC%B5%9C%EC%88%98%EC%98%81&paper_id=&key_name=%EC%B5%9C%EC%88%98%EC%98%81&key_locale=in(Choi, Suyoung) 2010-02-23 BK21 Seminar - EigenValue Problem II (Shu Feng Xu) 2010-02-23 KAIST Toric Topology Workshop 2010 - A convexity theorem for three tangled Hamiltonian torus actions (Hiraku Abe) 2010-02-23 KAIST Toric Topology Workshop 2010 - Introduction to lagrangian floer theory in toric manifolds 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4232&ko_name=%EC%A1%B0%EC%B2%A0%ED%98%84&paper_id=&key_name=%EC%A1%B0%EC%B2%A0%ED%98%84&key_locale=in(Cho, Cheol Hyun) 2010-02-23 KAIST Toric Topology Workshop 2010 - Introduction to lagrangian floer theory in toric manifolds 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4232&ko_name=%EC%A1%B0%EC%B2%A0%ED%98%84&paper_id=&key_name=%EC%A1%B0%EC%B2%A0%ED%98%84&key_locale=in(Cho, Cheol Hyun) 2010-02-23 KAIST Toric Topology Workshop 2010 - Symmetry of a symplectic toric manifold http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4424&ko_name=Mikiya+Masuda&paper_id=(Mikiya Masuda) 2010-02-22 KAIST Toric Topology Workshop 2010 - Coisotropic submanifolds of symplectic manifolds, leafwise fixed points, and presymplectic embeddings (Fabian Ziltener) 2010-02-22 KAIST Toric Topology Workshop 2010 - The cohomology ring of the GKM graph of a flag manifold (Yukiko Fukukawa) 2010-02-22 BK21 Seminar - EigenValue Problem I (Shu Feng Xu) 2010-02-22 KAIST Toric Topology Workshop 2010 - Symplectic real bott manifolds (Hiroaki Ishida) 2010-02-22 KAIST Toric Topology Workshop 2010 - Moment-angle manifolds in toric topology 2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4425&ko_name=Taras+PANOV&paper_id=(Taras panov) 2010-02-22 KAIST Toric Topology Workshop 2010 - Moment-angle manifolds in toric topology 1 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4425&ko_name=Taras+PANOV&paper_id=(Taras panov) 2010-02-22 KAIST Discrete Math Seminar - The 3-Color Problem http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4282&ko_name=Tommy+R.+Jensen&paper_id=&key_name=tommy&key_locale=in(R. Jensen) 2010-02-19 Lectures on Algebraic Surfaces by Miles Reid (WCU project) - Forthcoming paper containing new results on simply connected Godeaux surfaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2010-02-17 KAIST Discrete Math Seminar - The Fibonacci dimension of a graph http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4426&ko_name=Sergio+Cabello&paper_id=(Sergio Cabello) 2010-02-10 ASARC Seminar - III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4413&ko_name=Masanori+Morishita&paper_id=(Masanori Morishita) 2010-02-10 ASARC Seminar - II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4413&ko_name=Masanori+Morishita&paper_id=(Masanori Morishita) 2010-02-09 ASARC Seminar - I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4413&ko_name=Masanori+Morishita&paper_id=(Masanori Morishita) 2010-02-09 2010 KAIST Math Colloquium - Knots and Primes - Hyperbolic Geometry and Galois Deformation http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4413&ko_name=Masanori+Morishita&paper_id=(Masanori Morishita) 2010-02-08 KAIST Seminar - Mathematics of Bose Gas (Lee, Jioon) 2010-02-08 2010 ASARC WORKSHOP - Fermat's last theorem and deformation theory of Galois representations (Choi, Suhhyun) 2010-02-06 2010 ASARC WORKSHOP - Homological Mirror Symmetry conjecture. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4232&ko_name=%EC%A1%B0%EC%B2%A0%ED%98%84&paper_id=&key_name=%EC%A1%B0%EC%B2%A0%ED%98%84&key_locale=in(Cho Cheolhyun) 2010-02-06 2010 ASARC WORKSHOP - Homotopy algebras and non-commutative geometry. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4232&ko_name=%EC%A1%B0%EC%B2%A0%ED%98%84&paper_id=&key_name=%EC%A1%B0%EC%B2%A0%ED%98%84&key_locale=in(Cho Cheolhyun) 2010-02-06 2010 ASARC WORKSHOP - Special families of linear subspaces and their applications in algebraic geometry http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4427&ko_name=Fyodor+L.+Zak&paper_id=(Fyodor L. Zak) 2010-02-05 2010 ASARC WORKSHOP - Hilbert functions of almost reverse lexicographic ideals (Park, Jungpil) 2010-02-05 2010 ASARC WORKSHOP - Partial dg-categories and mixed over k[t]/(t^{m+1}) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4295&ko_name=%EB%B0%95%EC%A7%84%ED%98%84&paper_id=&key_name=%EB%B0%95%EC%A7%84%ED%98%84&key_locale=in(Park Jinhyun) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4295&ko_name=%EB%B0%95%EC%A7%84%ED%98%84&paper_id=&key_name=%EB%B0%95%EC%A7%84%ED%98%84&key_locale=in 2010-02-05 Lectures on Algebraic Surfaces by Miles Reid (WCU project) - More graded rings. Unprojection and applications http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2010-02-03 Lectures on Algebraic Surfaces by Miles Reid (WCU project) - Examples using graded rings, esp. Horikawa-Diccks,Bauer--Catanese--Pignatelli for pg=4,K^2=6 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2010-02-01 2010 Korean TEX Society Annual Meeting and Conference - Beamer TikZ (Cho, Myungchul) 2010-01-30 2010 Korean TEX Society Annual Meeting and Conference - TnXTeX and xoblivoir (Kim, Gangsoo) 2010-01-30 2010 Korean TEX Society Annual Meeting and Conference - Fontspec package (Lee, Juho) 2010-01-30 2010 Korean TEX Society Annual Meeting and Conference - XeTeX-ko (Kim, Dohyun) 2010-01-30 2010 Korean TEX Society Annual Meeting and Conference - Introduction to XeTeX (Cho, Jinhwan) 2010-01-30 2010 Korean TEX Society Annual Meeting and Conference - LuaTeX-ko (Kim, Dohyun) 2010-01-30 2010 Korean TEX Society Annual Meeting and Conference - Introduction to LuaTeX (Cho, Jinhwan) 2010-01-30 2010 Algebra and Geometry of Subvarieties of Projective Space - The k-secant lemma http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4429&ko_name=Christian+Peskine&paper_id=(Christian Peskine) 2010-01-29 2010 Algebra and Geometry of Subvarieties of Projective Space - Projective varieties whose automorphism groups have non-trivial prolongations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=2086&ko_name=%ED%99%A9%EC%A4%80%EB%AC%B5&paper_id=&key_name=%ED%99%A9%EC%A4%80%EB%AC%B5&key_locale=in(Hwang, Junmuk) 2010-01-29 2010 Algebra and Geometry of Subvarieties of Projective Space - Manifolds covered by lines, defective manifolds and a restricted Hartshorne Conjecture (Paltin Ionescue) 2010-01-29 2010 Algebra and Geometry of Subvarieties of Projective Space - Multisecants and normality of varieties of small codimension http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4427&ko_name=Fyodor+L.+Zak&paper_id=(Fyodor L. Zak) 2010-01-29 KAIST Discrete Math Seminar - Generalized Hamiltonian Cycles (Jakub Teska) 2010-01-28 2010 Algebra and Geometry of Subvarieties of Projective Space - Green's conjecture for curves on K3 surfaces http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4414&ko_name=Marian+Aprodu&paper_id=(Marian Aprodu) 2010-01-28 2010 Algebra and Geometry of Subvarieties of Projective Space - Projective subvarieties of degree=codimension+2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3952&ko_name=%EB%B0%95%EC%9D%98%EC%84%B1&paper_id=&key_name=%EB%B0%95%EC%9D%98%EC%84%B1&key_locale=in(Park, Euisung) 2010-01-28 2010 Algebra and Geometry of Subvarieties of Projective Space - Gauss maps in positive characteristic (KAJI Hajime) 2010-01-28 2010 Algebra and Geometry of Subvarieties of Projective Space - Triple covers of the projective plane with p_g=q=0 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4430&ko_name=Francesco+Polizzi&paper_id=(Francesco Polizzi) 2010-01-27 2010 Algebra and Geometry of Subvarieties of Projective Space - Log canonical thresholds of effective anticanonical divisors on Fano varieties http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=3735&ko_name=%EB%B0%95%EC%A7%80%ED%9B%88&paper_id=&key_name=%EB%B0%95%EC%A7%80%ED%9B%88&key_locale=in(Park Jihun) 2010-01-27 2010 Algebra and Geometry of Subvarieties of Projective Space - Codimension 4 Gorenstein varieties and unprojection http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4269&ko_name=Miles+Reid&paper_id= 2010-01-27 2010 Algebra and Geometry of Subvarieties of Projective Space - Defining ideal of the Segre locus in arbitrary characteristic (Katsuhisa Furukawa) 2010-01-27 2010 Algebra and Geometry of Subvarieties of Projective Space - Subscheme methods for nodal curves http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4428&ko_name=Ziv+Ran&paper_id=(Ziv Ran) 2010-01-27 ASARC Seminar - Koszul cohomology and algebraic geometry III http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4414&ko_name=Marian+Aprodu&paper_id=(Marian Aprodu) 2010-01-26 KAIST Discrete Math Seminar - Total fractional colorings of graphs with large girth http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4396&ko_name=Daniel+Kral%E2%80%99&paper_id=(Daniel Kral) 2010-01-26 KAIST BK21 Seminar - Finding Essential Surfaces in Cubical Complexes (Kim Sang Hyun) 2010-01-26 ASARC Seminar - Iwasawa theory for modular forms at supersingular primes (Kim Byung Doo) 2010-01-25 Lectures on Algebraic Surfaces by Miles Reid (WCU project) - Horikawa analysis for small K^2 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2010-01-25 ASARC seminar - Koszul cohomology and algebraic geometry II http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4414&ko_name=Marian+Aprodu&paper_id=(Marian Aprodu) 2010-01-25 ASARC seminar - Koszul cohomology and algebraic geometry I http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4414&ko_name=Marian+Aprodu&paper_id=(Marian Aprodu) 2010-01-25 KAIST Discrete Math Seminar - New interpretations for noncrossing partitions of classical types (Kim Jang Soo) 2010-01-21 Lectures on Algebraic Surfaces by Miles Reid (WCU project) - Godeaux and Campedelli surfaces, examples. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2010-01-20 KAIST Discrete Math Seminar - Algebraic versions of Removal Lemma http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4396&ko_name=Daniel+Kral%E2%80%99&paper_id=(Daniel Kral) 2010-01-19 ASARC Seminar - Space-Time-Block-Code(STBC) with nonvanishing determinant for p^{u}_{1} p^{v}_{2}/d^2 number of transit antennas http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4272&ko_name=Qin+Yue&paper_id=(Qin Yue) 2010-01-18 Lectures on Algebraic Surfaces by Miles Reid (WCU project) - Graded rings:basic examples, discussion of Proj, the Hilbert syzygies and Auslander--Buchsbaum theorems, Cohen-Macaulay and Gorenstein. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2010-01-18 International Conference on Mirror Symmetry and Gromov-Witten Theory - Landau-Ginzburg/Calabi-Yau correspondence http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4399&ko_name=Yongbin+Ruan&paper_id=(Yongbin Ruan) 2010-01-15 International Conference on Mirror Symmetry and Gromov-Witten Theory - Cydic Symmetry and numerical invariants in Lag. Floer theory http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4398&ko_name=Kenji+Fukaya&paper_id=(Kenji Fukaya) 2010-01-15 International Conference on Mirror Symmetry and Gromov-Witten Theory - A criterion for generating the Fukaya category http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4397&ko_name=Mohammed+Abouzaid&paper_id=(Mohammed Abouzaid) 2010-01-15 International Conference on Mirror Symmetry and Gromov-Witten Theory - On quantum cohomology of G/P' http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4395&ko_name=Conan+Leung&paper_id=(Conan Leung) 2010-01-14 International Conference on Mirror Symmetry and Gromov-Witten Theory - Local B-model and Mixed Hodge Structure http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4394&ko_name=Kazushi+Ueda&paper_id=(Yukiko Konishi) 2010-01-14 International Conference on Mirror Symmetry and Gromov-Witten Theory - A Kunneth theorem in Lagrangian Floer Theory (Lino Amorim) 2010-01-14 International Conference on Mirror Symmetry and Gromov-Witten Theory - Mirror Symmetry for Hypersurface Singularities (Atsushi Takahashi) 2010-01-14 International Conference on Mirror Symmetry and Gromov-Witten Theory - A conjecture of Duflo and the Ext algebra of branes (Andrei Calderaru) 2010-01-14 International Conference on Mirror Symmetry and Gromov-Witten Theory - Tropical coamoeba and equivariant homological mirror symmetry for the projective space http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4394&ko_name=Kazushi+Ueda&paper_id=(Kazushi Ueda) 2010-01-13 Lectures on Algebraic Surfaces by Miles Reid (WCU project) - Bogomolov instability, Miyaoka's inequality, more vanishing and more canonical embedding theorems. http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2010-01-13 International Conference on Mirror Symmetry and Gromov-Witten Theory - The Ooguri-Vafa Metric, Holomorphic Discs and Wall-Crossing (Kwok Wai Chan) 2010-01-13 International Conference on Mirror Symmetry and Gromov-Witten Theory - Floer cohomology of real Lagrangians in the Fermat quintic 3-fold (Garrett Alston) 2010-01-13 The 8th KAIST Geometric Topology Fair - A moduli space of Higgs bundles and a character variety3 (Kim Tae Jung) 2010-01-13 Winter School on Algorithms and Combinatorics 2010 - Graph cut algorithm with application to Computer Vision (Lim Yong Sub) 2010-01-13 International Conference on Mirror Symmetry and Gromov-Witten Theory - Spectra of Categories http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4389&ko_name=Ludmil+Katzarkov&paper_id=(Ludmil Katzarkov) 2010-01-13 The 8th KAIST Geometric Topology Fair - Introduction to arithmetic groups3 http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4392&ko_name=Dave+Witte+Morris&paper_id=(Dave Witte Morris) 2010-01-13 Winter School on Algorithms and Combinatorics 2010 - Finite-Size Scaling in Random k-Satisfiability Problem (Ha Mee Soon) 2010-01-13 International Conference on Mirror Symmetry and Gromov-Witten Theory - Mirror Symmetry And Realit http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4387&ko_name=Kentaro+Hori&paper_id=(Kentaro Hori) 2010-01-13 Winter School on Algorithms and Combinatorics 2010 - Width Parameters of Graphs http://www.mathnet.or.kr/new_sub04/sub04_01_01.php? no=4229&ko_name=%EC%97%84%EC%83%81%EC%9D%BC&paper_id=&key_name=%EC%97%84%EC%83%81%EC%9D%BC&key_locale=in(Oum Sangil) 2010-01-13 The 8th KAIST Geometric Topology Fair - Around Bennequin's inequality http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4618&ko_name=Stoimenow%2C+Alexander&paper_id=&key_name=Stoimenow&key_locale=in(Alexander Stoimenow) 2010-01-12 Winter School on Algorithms and Combinatorics 2010 - Algorithm design for ACM ICPC (Chin Tae jin, Ryu Won Ha) 2010-01-12 International Conference on Mirror Symmetry and Gromov-Witten Theory - Involutions, Obstructions and Mirror Symmetry http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4386&ko_name=Jake+Solomon&paper_id=(Jake Solomon) 2010-01-12 The 8th KAIST Geometric Topology Fair - Equivariant cohomological and cohomological rigidity of toric hyperKahler manifolds (Shintaro Kuroki) 2010-01-12 Winter School on Algorithms and Combinatorics 2010 - Triangulations of Convex Polygons - A Historical Note (Otfried Cheong) 2010-01-12 Winter School on Algorithms and Combinatorics 2010 - Complex networks and decentralized search algorithms (Kim Bo Young) 2010-01-12 International Conference on Mirror Symmetry and Gromov-Witten Theory - Donaldson-Thomas theory and cluster transformations http://www.mathnet.or.kr/new_sub04/sub04_01_01.php?no=4385&ko_name=Kentaro+Nagao&paper_id=(Kentaro Nagao) 2010-01-12 The 8th KAIST Geometric Topology Fair - Entropy rigidity and measures on the boundary of negatively curved metric spaces (Lim Seon Hee) 2010-01-12 The 8th KAIST Geometric Topology Fair - A moduli space of Higgs bundles and a character variety2 (Kim Tae Jung) 2010-01-12 Winter School on Algorithms and Combinatorics 2010 - Randomized Algorithms (Jung Kyomin) 2010-01-12 International Conference on Mirror Symmetry and Gromov-Witten Theory - Anti-symplectic involution and Floer cohomologyhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4383&ko_name=Hiroshi+Ohta&paper_id=(HiroshiOhta) 2010-01-12 The8thKAIST GeometricTopologyFair -Introductiontoarithmeticgroups2http://www mathnetorkr/new_sub04/sub04_01_01php?no=4392&ko_name=Dave+Witte+Morris&paper_id=(DaveWitteMorris) 2010-01-12 Winter SchoolonAlgorithms andCombinatorics 2010 -GeometricGraphs http://www mathnetorkr/new_sub04/sub04_01_01php?no=4285&ko_name=%EC%95%88%ED%9D%AC%EA%B0%91&paper_id=&key_name=%EC%95%88%ED%9D%AC%EA%B0%91&key_locale=in(Ahn HeeKap) 2010-01-12 InternationalConferenceonMirror SymmetryandGromov-WittenTheory -Gradient-likevectorfields oncomplexanalyticvarieties http://www mathnetorkr/new_sub04/sub04_01_01php? no=4232&ko_name=%EC%A1%B0%EC%B2%A0%ED%98%84&paper_id=&key_name=%EC%A1%B0%EC%B2%A0%ED%98%84&key_locale=in(ChoCheolHyun) 2010-01-12 Winter SchoolonAlgorithms andCombinatorics 2010 -ParameterizedComplexityhttp://www mathnetorkr/new_sub04/sub04_01_01php? no=4229&ko_name=%EC%97%84%EC%83%81%EC%9D%BC&paper_id=&key_name=%EC%97%84%EC%83%81%EC%9D%BC&key_locale=in(OumSangil) 2010-01-12 Winter SchoolonAlgorithms andCombinatorics 2010 -DynamicMarkovchainMonteCarloandits applicationtonetworkalgorithms (ShinJinWoo) 2010-01-11 Winter SchoolonAlgorithms andCombinatorics 2010 -Cook-LevinTheorem(KwakNamju) 2010-01-11 The8thKAIST GeometricTopologyFair -Quasiconformalnonstabilityforisometrygroups inhyperbolic4-space(KimYoungju) 2010-01-11 Lectures onAlgebraicSurfaces byMiles Reid(WCU project) -Canonicalembeddings (inthestyleofKodaira--Ramanujam--Bombieri withmorerecentimprovements)http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid)http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id= 2010-01-11 The8thKAIST GeometricTopologyFair -TopologyandDynamics ofBiologicalNetworks (KimJeongRae) 2010-01-11 Winter SchoolonAlgorithms andCombinatorics 2010 -NP-Completeness (JungKyomin) 2010-01-11 The8thKAIST GeometricTopologyFair -y-coordinates ofellipticcurves (ShinDongHwa) 2010-01-11 Winter SchoolonAlgorithms andCombinatorics 2010 -GeometricAlgorithms http://www mathnetorkr/new_sub04/sub04_01_01php? no=4285&ko_name=%EC%95%88%ED%9D%AC%EA%B0%91&paper_id=&key_name=%EC%95%88%ED%9D%AC%EA%B0%91&key_locale=in(AhnHeeKap) 2010-01-11 The8thKAIST GeometricTopologyFair -A modulispaceofHiggs bundles andacharactervariety1(KimTaeJung) 2010-01-11 The8thKAIST GeometricTopologyFair -Introductiontoarithmeticgroups1http://www mathnetorkr/new_sub04/sub04_01_01php?no=4392&ko_name=Dave+Witte+Morris&paper_id=(DaveWitteMorris) 2010-01-11 http://www mathnetorkr/new_sub04/sub04_01_01php?no=1918&ko_name=%EC%B5%9C%EC%9E%AC%EA%B2%BD&paper_id=&key_name=%EC%B5%9C%EC%9E%AC%EA%B2%BD&key_locale=in(Choe Jaigyoung) 2010-01-08 : http://www mathnetorkr/new_sub04/sub04_01_01php?no=2340&ko_name=%EC%98%A4%EC%9A%A9%EA%B7%BC&paper_id=&key_name=%EC%98%A4%EC%9A%A9%EA%B7%BC&key_locale=in(Oh Yong-Geun) 2010-01-08 http://www mathnetorkr/new_sub04/sub04_01_01php?no=2086&ko_name=%ED%99%A9%EC%A4%80%EB%AC%B5&paper_id=&key_name=%ED%99%A9%EC%A4%80%EB%AC%B5&key_locale=in(Hwang Jun-Muk) 2010-01-07 http://www mathnetorkr/new_sub04/sub04_01_01php?no=612&ko_name=%EB%B0%95%EC%A2%85%EC%9D%BC&paper_id=&key_name=%EB%B0%95%EC%A2%85%EC%9D%BC&key_locale=in(Park Jongil) 2010-01-07 Backtotopofpage 2009 KAIST Seminar -Applicationofalgebraicgeometryininformationtheoryhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4391&ko_name=Frederic+Edoukou&paper_id=(FredericEdoukou) 2009-12-29 KAIST Seminar -Mathematics ofquantummany-particlesystems (LeeJioon) 2009-12-29 KAIST DiscreteMathSeminar -OnGromovConjectureandTopologicalJigsaw Puzzlehttp://www mathnetorkr/new_sub04/sub04_01_01php? no=4058&ko_name=%EA%B9%80%EC%83%81%ED%98%84&paper_id=&key_name=%EA%B9%80%EC%83%81%ED%98%84&key_locale=in(KimSanghyun) 2009-12-28 ASARCSeminar -Multipointseshadriconstants onsurfaces http://www mathnetorkr/new_sub04/sub04_01_01php?no=4382&ko_name=Brian+Harbourne&paper_id=(BrianHarbourne) 2009-12-23 KAIST DiscreteMathSeminar -SolvingMAX-r-SATaboveaTightLowerBound(KimEunJung) 2009-12-23 ASARCSeminar -Bilipschitzequivalenceis notequivalenttoquasi-isometricequivalenceforfinitelygeneratedgroups (TuliaDymarz) 2009-12-22 ASARCSeminar -Structureofprojectivevarieties withnon-birationallinearprojections andits applications http://www mathnetorkr/new_sub04/sub04_01_01php?no=4384&ko_name=Atsushi+Noma&paper_id=(AtsushiNoma) 2009-12-22 WorkshoponModuliandBirationalGeometry -Plurigeneraandinvariants ofcanonicaln-folds http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2009-12-22 ASARCSeminar -Matroids Hilbertfunctions andgradedBettinumbers http://www mathnetorkr/new_sub04/sub04_01_01php?no=4382&ko_name=Brian+Harbourne&paper_id=(BrianHarbourne) 2009-12-22 WorkshoponModuliandBirationalGeometry -Gonalityandinjectivityradius ofacompactRiemannsurfacehttp://www mathnetorkr/new_sub04/sub04_01_01php? no=2086&ko_name=%ED%99%A9%EC%A4%80%EB%AC%B5&paper_id=&key_name=%ED%99%A9%EC%A4%80%EB%AC%B5&key_locale=in(Jun-MukHwang) 2009-12-22 WorkshoponModuliandBirationalGeometry -Finitegenerationofthecanonicalring:yetanotherproofhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4390&ko_name=Paolo+Cascini&paper_id=(PaoloCascini) 2009-12-22 WorkshoponModuliandBirationalGeometry -BirationalBoundedness ofopenvarieties http://www mathnetorkr/new_sub04/sub04_01_01php?no=4388&ko_name=James+McKernan&paper_id=(James McKernan) 2009-12-22 ASARCSeminar -Openproblems relatedto0-dimensionalsubschemes inprojectivespaces http://www mathnetorkr/new_sub04/sub04_01_01php?no=4382&ko_name=Brian+Harbourne&paper_id=(BrianHarbourne) 2009-12-21 WorkshoponModuliandBirationalGeometry -Logminimalmodelprogramformodulispaces ofpointedcurves (DavidSmyth) 2009-12-21 ASARCSeminar -Shortexactsequences relatedtotrimmingfatpoints vialines (SusanCooper) 2009-12-21 KAIST-KonkukMathematicalBiologyWorkshop -Theeffectofgeometricshapeofheartoncardiacelectricpropagation(ChunSehun) 2009-12-21 WorkshoponModuliandBirationalGeometry -Rigidcurves onmodulispaces (DaweiChen) 2009-12-21 KAIST-KonkukMathematicalBiologyWorkshop -Generationofirregularactivityinanexcitatory-inhibitorynetwork(ParkChoongseok) 2009-12-21 KAIST DiscreteMathSeminar -Combinatorialproblems inrandommatrixtheoryhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4431&ko_name=Van+Ha+Vu&paper_id=(VanHaVu) 2009-12-21 KAIST-KonkukMathematicalBiologyWorkshop -Immersedboundaryformalism fromcontroltodesigninbiology fluidandmaterialscience(LeePilhwa) 2009-12-21 WorkshoponModuliandBirationalGeometry -Logminimalmodelprogramforthemoduliofcurves:Anoutlineandthegenus 4case http://www mathnetorkr/new_sub04/sub04_01_01php? no=4314&ko_name=%ED%98%84%EB%8F%99%ED%9B%88&paper_id=&key_name=%ED%98%84%EB%8F%99%ED%9B%88&key_locale=in(DonghoonHyeon) 2009-12-21 KAIST-KonkukMathematicalBiologyWorkshop -Thebiomechanics ofproteinfoldingandapplications (KangYeona) 2009-12-21 WorkshoponModuliandBirationalGeometry -Notes onthebirationalgeometryofthemodulispaceofgenus 4curves (RaduLaza) 2009-12-21 KAIST-KonkukMathematicalBiologyWorkshop -A hybridmodelofinteractionbetweentumorcells andmicroenvironment(KimYangjin) 2009-12-21 KAIST-KonkukMathematicalBiologyWorkshop -A mathematicalmodelforthemorphogengradientformationandinterpretationduringthedevelopment(ChoEunjoo) 2009-12-21 WorkshoponModuliandBirationalGeometry -Complements toGiesekers constructionof$\overline{M}_g$http://www mathnetorkr/new_sub04/sub04_01_01php?no=4697&ko_name=Ian+Morrison(IanMorrison) 2009-12-21 KAIST Seminar -IntroductiontocollapsedRiemannianmanifolds withboundedsectionalcurvature(RongXiaochun) 2009-12-17 HotTopics WorkshoponAlgebraicCombinatorics -cd-indexofmatroidbasepolytopes http://www mathnetorkr/new_sub04/sub04_01_01php? no=5057&ko_name=%EA%B9%80%EC%83%81%EC%9A%B1&paper_id=&key_name=%EA%B9%80%EC%83%81%EC%9A%B1&key_locale=in(KimSangwook) 2009-12-15 HotTopics WorkshoponAlgebraicCombinatorics -TheJordantypes ofcertainnilpotentmatrices http://www mathnetorkr/new_sub04/sub04_01_01php?no=4698&ko_name=Itaru+Terada&paper_id=(ItaruTerada) 2009-12-15 HotTopics WorkshoponAlgebraicCombinatorics -Onextremalweightcrystals forthegenerallinearLiealgebraoftype$A_\+∞$http://www mathnetorkr/new_sub04/sub04_01_01php? no=2249&ko_name=%EA%B6%8C%EC%9E%AC%ED%9B%88&paper_id=&key_name=%EA%B6%8C%EC%9E%AC%ED%9B%88&key_locale=in(KwonJaeHoon) 2009-12-15 HotTopics WorkshoponAlgebraicCombinatorics -Two-Parameterdeformationofmultivariatehookproductformulaehttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4432&ko_name=Soichi+Okada&paper_id=(SoichiOkada) 2009-12-15 HotTopics WorkshoponAlgebraicCombinatorics -Theq-EulurianPolynomials http://www mathnetorkr/new_sub04/sub04_01_01php?no=4472&ko_name=Michelle+L+Wachs&paper_id=(MichelleWachs)/200912/MichelleWachs mp42009-12-15 Discreterandom matrices anduniversity -Discreterandommatrices anduniversityhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4435&ko_name=Terence+Chi-Shen+Tao&paper_id=(TerenceTao) 2009-12-15 HotTopics WorkshoponAlgebraicCombinatorics -Singularities ofSchubertvarieties http://www mathnetorkr/new_sub04/sub04_01_01php?no=4705&ko_name=Alexander+Yong&paper_id=(AlexanderYong) 2009-12-14 ASARCSeminar -IntrodcutiontoBoij-SoderbergtheoryIIhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4377&ko_name=Jerzy+Weyman&paper_id=&key_name=jerzy&key_locale=out(JerzyWeyman) 2009-12-14 ASARCSeminar -IntrodcutiontoBoij-SoderbergtheoryIIIhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4377&ko_name=Jerzy+Weyman&paper_id=&key_name=jerzy&key_locale=out(JerzyWeyman) 2009-12-14 HotTopics WorkshoponAlgebraicCombinatorics -Coloredpermutations andgeneralizations ofderangements (SeoSeunghyun) 2009-12-14 HotTopics WorkshoponAlgebraicCombinatorics -p-Partitions inpermutationenumerationhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=2492&ko_name=Ira+M +Gessel&paper_id=Gessel%28bran1%29&key_name=Ira&key_locale=out(IraGessel) 2009-12-14 HotTopics WorkshoponAlgebraicCombinatorics -TheCombinatorics ofqt-CatalanNumbers andtheSpaceofDiagonalHarmonics http://www mathnetorkr/new_sub04/sub04_01_01php?no=4433&ko_name=James+Haglund&paper_id=(James Haglund) 2009-12-14 HotTopics WorkshoponAlgebraicCombinatorics -AlternatingPermutations andmthDescents http://www mathnetorkr/new_sub04/sub04_01_01php?no=3323&ko_name=Ae+Ja+Yee&paper_id=Yee&key_name=Ae+Ja&key_locale=out(AeJaYee) 2009-12-14 HotTopics WorkshoponAlgebraicCombinatorics -Animtroductiontothcyclicsievingphenomenonhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=2514&ko_name=Bruce+Sagan&paper_id=Sagan%28michi9%29&key_name=Bruce&key_locale=out(BruceSagan) 2009-12-14 Recentprogress inadditiveprimenumber theory -Recentprogress inadditiveprimenumbertheoryhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4435&ko_name=Terence+Chi-Shen+Tao&paper_id=(TerenceTao) 2009-12-14 Facetheworldwithmathematicalmind -GameTheoryandRationality(LeeInHo) 2009-12-11 ASARCSeminar -IntrodcutiontoBoij-SoderbergtheoryIhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4377&ko_name=Jerzy+Weyman&paper_id=&key_name=jerzy&key_locale=out(JerzyWeyman) 2009-12-11 -Findingneighbors intheatomicworld-thestoryofX-rayandneutronscattering( ) 2009-12-11 KAIST (2009 2 ) -BoijSoderbergconjectures onBettitables ofgradedmodules http://www mathnetorkr/new_sub04/sub04_01_01php?no=4377&ko_name=Jerzy+Weyman&paper_id=&key_name=jerzy&key_locale=out(JerzyWeyman) 2009-12-10 ASARCSeminar -Onthebehaviorofsyzygies ofaprojectiveschemeunderinnerprojection (HanKangjin) 2009-12-08 ASARCSeminar -Onthesum$\sum^{n}_{k=1}[\sqrt{2k}]$http://www mathnetorkr/new_sub04/sub04_01_01php?no=343&ko_name=%EA%B9%80%ED%98%84%EA%B4%91&paper_id=&key_name=%EA%B9%80%ED%98%84%EA%B4%91&key_locale=in(Kim HyunKwang) 2009-12-04 KAIST (2009 2 ) -GlobalDynamics BeyondUniformHyperbolicity http://www mathnetorkr/new_sub04/sub04_01_01php? no=1149&ko_name=%EC%9D%B4%EA%B1%B4%ED%9D%AC&paper_id=&key_name=%EC%9D%B4%EA%B1%B4%ED%9D%AC&key_locale=in(LeeKeonHee) 2009-12-03 -Waterresources inmongoliaandgroundwatermodelling(Prof NemerBuyankhish) 2009-12-03 KAIST DiscreteMathSeminar -DescribingPolynomials as EquivalenttoExplicitSolutions http://www mathnetorkr/new_sub04/sub04_01_01php?no=4376&ko_name=Uwe+Schauz&paper_id=&key_name=uwe&key_locale=out(UweSchauz) 2009-12-02 ASARCSeminar -Hilbertschemeofrationalcubiccurves viastablemaps (ChungKiryong) 2009-12-01 KAIST (2009 2 ) -Thedisjointpaths problem:StructureandAlgorithmhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4362&ko_name=Ken-ichi+Kawarabayas&paper_id=&key_name=ken-ichi&key_locale=out(Ken-ichiKawarabayashi) 2009-11-26 KAIST DiscreteMathSeminar -Graphs withoutsubdivisions http://www mathnetorkr/new_sub04/sub04_01_01php?no=4362&ko_name=Ken-ichi+Kawarabayas&paper_id=&key_name=ken-ichi&key_locale=out(Ken-ichiKawarabayashi) 2009-11-24 -Directdeterminationofstackingdisorderinkaolinitebyhrtem(Prof ToshihiroKogure) 2009-11-24 4thKIASWORKSHOPONDIFFERENTIAL GEOMETRY -ConstainMeanCurvatrueSurfaces inHomogeneous Manifolds -10http://www mathnetorkr/new_sub04/sub04_01_01php?no=4372&ko_name=Benoit+Daniel&paper_id=&key_name=benoit&key_locale=out(BenoitDaniel) 2009-11-21 4thKIASWORKSHOPONDIFFERENTIAL GEOMETRY -ConstainMeanCurvatrueSurfaces inHomogeneous Manifolds -12http://www mathnetorkr/new_sub04/sub04_01_01php?no=4375&ko_name=Pablo+Mira&paper_id=&key_name=mira&key_locale=out(PabloMira) 2009-11-21 4thKIASWORKSHOPONDIFFERENTIAL GEOMETRY -ConstainMeanCurvatrueSurfaces inHomogeneous Manifolds -11http://www mathnetorkr/new_sub04/sub04_01_01php?no=4373&ko_name=Hauswirth%2C+Laurent&paper_id=&key_name=Hauswirth&key_locale=out(Laurent Hauswirth) 2009-11-21 4thKIASWORKSHOPONDIFFERENTIAL GEOMETRY -ConstainMeanCurvatrueSurfaces inHomogeneous Manifolds -9http://www mathnetorkr/new_sub04/sub04_01_01php?no=4375&ko_name=Pablo+Mira&paper_id=&key_name=mira&key_locale=out(PabloMira) 2009-11-20 KAIST (2009 2 ) -Whats goingoninandwithmodernfinance?http://www mathnetorkr/new_sub04/sub04_01_01php?no=1943&ko_name=%EC%B5%9C%ED%98%95%EC%9D%B8&paper_id=&key_name=%EC%B5%9C%ED%98%95%EC%9D%B8&key_locale=in(Choi HyeongIn) 2009-11-20 4thKIASWORKSHOPONDIFFERENTIAL GEOMETRY -ConstainMeanCurvatrueSurfaces inHomogeneous Manifolds -8http://www mathnetorkr/new_sub04/sub04_01_01php?no=4373&ko_name=Hauswirth%2C+Laurent&paper_id=&key_name=Hauswirth&key_locale=out(Laurent Hauswirth) 2009-11-20 4thKIASWORKSHOPONDIFFERENTIAL GEOMETRY -ConstainMeanCurvatrueSurfaces inHomogeneous Manifolds -7http://www mathnetorkr/new_sub04/sub04_01_01php?no=4372&ko_name=Benoit+Daniel&paper_id=&key_name=benoit&key_locale=out(BenoitDaniel) 2009-11-20 KAIST Seminar -AnalyticalandNumericalMethods forMaxwells Equations 10(SimImbo) 2009-11-20 KAIST Seminar -AnalyticalandNumericalMethods forMaxwells Equations 9(SimImbo) 2009-11-20 MoodleandNoodles -Sloodle:MoodleinSecondLife(Chris Surridge) 2009-11-19 MoodleandNoodles -Moodles Anti-plagiarismPluginDemo(SergeyButakov) 2009-11-19 MoodleandNoodles -UsingtheVoiceRecorderforESL(MikePeacock) 2009-11-19 MoodleandNoodles -UsingQuizzes as Homeworkas a(KimberlyHogg) 2009-11-19 MoodleandNoodles -Moodleas aSustainableOCWDevelopmentPlatform(ParkJongDae) 2009-11-19 KAIST Seminar -AnalyticalandNumericalMethods forMaxwells Equations 8(SimImbo) 2009-11-19 KAIST Seminar -AnalyticalandNumericalMethods forMaxwells Equations 7(SimImbo) 2009-11-19 KAIST Seminar -AnalyticalandNumericalMethods forMaxwells Equations 6(SimImbo) 2009-11-18 KAIST Seminar -AnalyticalandNumericalMethods forMaxwells Equations 5(SimImbo) 2009-11-18 KAIST Seminar -AnalyticalandNumericalMethods forMaxwells Equations 4(SimImbo) 2009-11-17 KAIST Seminar -AnalyticalandNumericalMethods forMaxwells Equations 3(SimImbo) 2009-11-17 KAIST Seminar -AnalyticalandNumericalMethods forMaxwells Equations 2(SimImbo) 2009-11-16 KAIST Seminar -AnalyticalandNumericalMethods forMaxwells Equations 1(SimImbo) 2009-11-16 4thKIASWORKSHOPONDIFFERENTIAL GEOMETRY -ConstainMeanCurvatrueSurfaces inHomogeneous Manifolds -4http://www mathnetorkr/new_sub04/sub04_01_01php?no=4372&ko_name=Benoit+Daniel&paper_id=&key_name=benoit&key_locale=out(BenoitDaniel) 2009-11-14 Tables inDocuments alongwithXeLaTeX (KimGangSoo) 2009-11-14 Tables inDocuments alongwithXeLaTeX (LeeKiHwang) 2009-11-14 4thKIASWORKSHOPONDIFFERENTIAL GEOMETRY -ConstainMeanCurvatrueSurfaces inHomogeneous Manifolds -6http://www mathnetorkr/new_sub04/sub04_01_01php?no=4375&ko_name=Pablo+Mira&paper_id=&key_name=mira&key_locale=out(PabloMira) 2009-11-14 Tables inDocuments alongwithXeLaTeX -XeTeX-ko (KimGangSoo) 2009-11-14 4thKIASWORKSHOPONDIFFERENTIAL GEOMETRY -ConstainMeanCurvatrueSurfaces inHomogeneous Manifolds -5http://www mathnetorkr/new_sub04/sub04_01_01php?no=4373&ko_name=Hauswirth%2C+Laurent&paper_id=&key_name=Hauswirth&key_locale=out(Laurent Hauswirth) 2009-11-14 Tables inDocuments alongwithXeLaTeX -XeTeX koTeX :XeTeX-ko(KimDoHyun) 2009-11-14 4thKIASWORKSHOPONDIFFERENTIAL GEOMETRY -ConstainMeanCurvatrueSurfaces inHomogeneous Manifolds -3http://www mathnetorkr/new_sub04/sub04_01_01php?no=4375&ko_name=Pablo+Mira&paper_id=&key_name=mira&key_locale=out(PabloMira) 2009-11-13 4thKIASWORKSHOPONDIFFERENTIAL GEOMETRY -ConstainMeanCurvatrueSurfaces inHomogeneous Manifolds -2http://www mathnetorkr/new_sub04/sub04_01_01php?no=4373&ko_name=Hauswirth%2C+Laurent&paper_id=&key_name=Hauswirth&key_locale=out(Laurent Hauswirth) 2009-11-13 InternationalConferenceonSymplecticContactandLowDimensionalTopology -Onthegroupofstrongsymplectichomeomorphisms http://www mathnetorkr/new_sub04/sub04_01_01php?no=4361&ko_name=Augustin+Banyaga&paper_id=&key_name=banyaga&key_locale=out(Augustin Banyaga) 2009-11-13 4thKIASWORKSHOPONDIFFERENTIAL GEOMETRY -ConstainMeanCurvatrueSurfaces inHomogeneous Manifolds -1http://www mathnetorkr/new_sub04/sub04_01_01php?no=4372&ko_name=Benoit+Daniel&paper_id=&key_name=benoit&key_locale=out(BenoitDaniel) 2009-11-13 InternationalConferenceonSymplecticContactandLowDimensionalTopology -Spectralinvariants andtheenergy-capacityinequalityhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4354&ko_name=Michael+Usher&paper_id=&key_name=usher&key_locale=out(MichaelUsher) 2009-1113 InternationalConferenceonSymplecticContactandLowDimensionalTopology -GeneralizingMorsetheorytothestudyofgenericmaps tosurfaces http://www mathnetorkr/new_sub04/sub04_01_01php?no=4360&ko_name=David+TGay&paper_id=&key_name=david&key_locale=out(David Gay) 2009-11-13 InternationalConferenceonSymplecticContactandLowDimensionalTopology -CombinatorialHeegaardFloerhomologyhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4351&ko_name=Andras+Stipsicz&paper_id=&key_name=andras&key_locale=out(Andras Stipsicz) 2009-11-13 -Groundwaterartificialrechargeforanadaptationtoclimatechange:applicationtoJejuIsland( ) 2009-11-13 InternationalConferenceonSymplecticContactandLowDimensionalTopology -L2-signatures homology andamenablegroups http://www mathnetorkr/new_sub04/sub04_01_01php? no=3904&ko_name=%EC%B0%A8%EC%9E%AC%EC%B6%98&paper_id=&key_name=%EC%B0%A8%EC%9E%AC%EC%B6%98&key_locale=in(ChaJaeChoon) 2009-11-12 InternationalConferenceonSymplecticContactandLowDimensionalTopology -Lefschetzfibrationstructures onknotsurgery4-manifolds http://www mathnetorkr/new_sub04/sub04_01_01php? no=3815&ko_name=%EC%9C%A4%EA%B8%B0%ED%97%8C&paper_id=&key_name=%EC%9C%A4%EA%B8%B0%ED%97%8C&key_locale=in(YunKiHeon) 2009-11-12 ASARCSeminar -A counterexampleofaconjectureofBloch-Katoandinfinitetorsioninzero-cycles overalocalfield http://www mathnetorkr/new_sub04/sub04_01_01php?no=4322&ko_name=Shuji+Saito&paper_id=&key_name=saito&key_locale=out(ShujiSaito) 2009-11-12 InternationalConferenceonSymplecticContactandLowDimensionalTopology -Contactstructures andcategorificationhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4349&ko_name=Ko+Honda&paper_id=&key_name=honda&key_locale=out(KoHonda) 2009-11-12 InternationalConferenceonSymplecticContactandLowDimensionalTopology -Remarks onsymplecticfillings oflinks ofisolatedsurfacesingularities http://www mathnetorkr/new_sub04/sub04_01_01php?no=4357&ko_name=Kaoru+Ono&paper_id=&key_name=ono&key_locale=out(Kaoru Ono) 2009-11-12 InternationalConferenceonSymplecticContactandLowDimensionalTopology -ThefilteredFloercomplexhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4354&ko_name=Michael+Usher&paper_id=&key_name=usher&key_locale=out(MichaelUsher) 2009-11-12 2009 ( ) 2009-11-12 2009 ( ) 2009-11-12 2009 50kHztonpilz ( ) 2009-11-12 2009 ( ) 2009-11-12 2009 -LED (1)( ) 2009-11-12 2009 Trachurus japonicus TemmincketSchlegel ( ) 2009-11-12 2009 (SFA) ( ) 2009-11-12 2009 ( ) 2009-11-12 2009 ( ) 2009-11-12 2009 ( ) 2009-11-12 2009 -Effects ofdietarycarotenoidsourceandlevelongrowthandskinpigmentationofjuvenileoliveflounder Paralichthys olivaceus (MinhAnhPham) 2009-11-12 2009 -Effects ofdietaryMakgeolliby-products ongrowthperformanceandbodycompositionofjuvenileoliveflounder Paralichthysolivaceus (KiMinBae) 2009-11-12 2009 -Influenceofdietarylipidsources onfattyacids compositionofjuvenileandgrowerflounder(Paralichthys olivaceus)(DongGyuKim) 2009-11-12 2009 × ;F 1 ( ) 2009-11-12 2009 ( ) 2009-11-12 2009 ( ) 2009-11-12 2009 -BFT(biofloctechnology) ( ) 2009-11-12 2009 -Growthcomparisons ofredseabream(Pagrus major)inlaboratoryscalerecirculatingsystems withthreedifferentbiofiltermedia(DickyHarwanto) 2009-11-12 2009 -Familyproductionofthefleshprawn Fenneropenaeus chinensis bythebreedingprogramforgeneticimprovement(BongSeokKim) 2009-11-12 2009 -Evaluationofdietarycadmiumtoxiclevelinjuvenileoliveflounder(Paralichthys olivaceus)(JunHoLee) 2009-11-12 2009 -InteractionbetweendietaryMethionineandCholineinjuvenileBeluga Husohuso(Mohseni M ) 2009-11-12 2009 -Enternalultrastructureontheovulationprocess andmicropyleofgrouper Epinephelus sp (SeongHoonKim) 2009-11-12 2009 Epinephelus akaara ( ) 2009-11-12 2009 squidzone ( ) 2009-11-12 2009 (CDM) ( ) 2009-11-12 2009 ( ) 2009-11-12 2009 (Arctoscopus japonicus) ( ) 2009-11-12 2009 ( ) 2009-11-12 2009 ( ) 2009-11-12 2009 ( ) 2009-11-12 InternationalConferenceonSymplecticContactandLowDimensionalTopology -CombinatorialHeegaardFloerhomologyhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4351&ko_name=Andras+Stipsicz&paper_id=&key_name=andras&key_locale=out(Andras Stipsicz) 2009-11-10 InternationalConferenceonSymplecticContactandLowDimensionalTopology -C0-symplectictopologyandHamiltonianhomeomorphisms http://www mathnetorkr/new_sub04/sub04_01_01php?no=4356&ko_name=Stefan+Mueller&paper_id=&key_name=stefan&key_locale=out(Stefan Mueller) 2009-11-10 InternationalConferenceonSymplecticContactandLowDimensionalTopology -Contactstructures andcategorificationhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4349&ko_name=Ko+Honda&paper_id=&key_name=honda&key_locale=out(KoHonda) 2009-11-10 InternationalConferenceonSymplecticContactandLowDimensionalTopology -Monodromysubstitutions andrationalblowdowns http://www mathnetorkr/new_sub04/sub04_01_01php?no=4355&ko_name=Thomas+Mark&paper_id=&key_name=thomas&key_locale=out(Thomas Mark) 200911-10 InternationalConferenceonSymplecticContactandLowDimensionalTopology -IntroductiontoHamiltonianFloerhomologyhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4354&ko_name=Michael+Usher&paper_id=&key_name=usher&key_locale=out(MichaelUsher) 2009-11-10 InternationalConferenceonSymplecticContactandLowDimensionalTopology -Diagrams forcontact5-manifolds http://www mathnetorkr/new_sub04/sub04_01_01php?no=4353&ko_name=Otto+van+Koert&paper_id=&key_name=otto&key_locale=out(OttovanKoert) 2009-11-09 InternationalConferenceonSymplecticContactandLowDimensionalTopology -CombinatorialHeegaardFloerhomologyhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4351&ko_name=Andras+Stipsicz&paper_id=&key_name=andras&key_locale=out(Andras Stipsicz) 2009-11-09 InternationalConferenceonSymplecticContactandLowDimensionalTopology -A holomorphic0-surgerymodelwithapplicationtocylindricalcontacthomologyhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4350&ko_name=MeiLin+Yau&paper_id=&key_name=yau&key_locale=out(Mei-LinYau) 2009-11-09 InternationalConferenceonSymplecticContactandLowDimensionalTopology -Contactstructures andcategorificationhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4349&ko_name=Ko+Honda&paper_id=&key_name=honda&key_locale=out(KoHonda) 2009-11-09 The13thInternationalWorkshoponDifferentialGeometryandRelatedFields -ParabolicGeodesics in3-dimensionalSasakianManifolds (LeeJiEun) 2009-11-07 Conferencefor EllipticandParabolicPDEs -Asymptoticagreementofmoments andhigherordercontractionintheBurgers equationhttp://www mathnetorkr/new_sub04/sub04_01_01php? no=4112&ko_name=%EA%B9%80%EC%9A%A9%EC%A0%95&paper_id=&key_name=%EA%B9%80%EC%9A%A9%EC%A0%95&key_locale=in(KimYongJung) 2009-11-07 Conferencefor EllipticandParabolicPDEs -Supercriticalgravitywaves generatedbyapositiveforce-TheoryandExperimenthttp://www mathnetorkr/new_sub04/sub04_01_01php? no=1924&ko_name=%EC%B5%9C%EC%A0%95%ED%99%98&paper_id=&key_name=%EC%B5%9C%EC%A0%95%ED%99%98&key_locale=in(ChoiJeonhwan) 2009-11-07 The13thInternationalWorkshoponDifferentialGeometryandRelatedFields -RealHypersusrfaces inComplexProjectiveSpacewithPseudoD-ParallelStructureJacobiOperator(LeeHyunjin) 2009-11-07 Conferencefor EllipticandParabolicPDEs -Someremarks onsingularsolutions ofnonlinearellipticequations http://www mathnetorkr/new_sub04/sub04_01_01php?no=2420&ko_name=Yanyan+Li&paper_id=Rutgers12&key_name=Yanyan&key_locale=out(YanyanLi) 2009-11-07 The13thInternationalWorkshoponDifferentialGeometryandRelatedFields -RealHypersusrfaces inComplexTwo-PlaneGrassmannians whoseNarmalJacobiOperatoris D-Parallel(JeongImsoon) 2009-11-07 Conferencefor EllipticandParabolicPDEs -Ellipticestimates independentofdomainexpansion(ChoYonggeun) 2009-11-06 Conferencefor EllipticandParabolicPDEs -MixedboundaryvalueproblemoftheLaplaceequation(ChangTongKeun) 2009-11-06 Facetheworldwithmathematicalmind (Park SungHyun) 2009-11-06 The13thInternationalWorkshoponDifferentialGeometryandRelatedFields -RealHypersusrfaces inComplexSpaceForms andtheGeneralizedTanaka-WebsterConnectionhttp://www mathnetorkr/new_sub04/sub04_01_01php? no=4378&ko_name=Mayuko+Kon&paper_id=&key_name=mayuko&key_locale=out(MayukoKon) 2009-11-06 Conferencefor EllipticandParabolicPDEs -Exponentialdecayofsolutions fordispersionmanagednon-linearSchrodingerequation(LeeYoungRan) 2009-11-06 The13thInternationalWorkshoponDifferentialGeometryandRelatedFields -Hypersurfaces inaUnitSpherewithConstantm-thMeanCurvanturehttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4379&ko_name=Wei%2C+Guoxin&paper_id=&key_name=wei&key_locale=out(Guoxin Wei) 2009-11-06 Conferencefor EllipticandParabolicPDEs -Theminimizers ofCaffarelli-Kohn-Nirenberginequalities withthesingularityontheboundaryofdomains http://www mathnetorkr/new_sub04/sub04_01_01php?no=4436&ko_name=Chang-Shou+Lin&paper_id=(Chang-ShouLin) 2009-11-06 The13thInternationalWorkshoponDifferentialGeometryandRelatedFields -OntheGieseker-SimpsonModuliSpaces ofVectorBundles onAlgebraicSurfaces http://www mathnetorkr/new_sub04/sub04_01_01php? no=3701&ko_name=%EC%B5%9C%EC%9E%AC%EC%9C%A0&paper_id=&key_name=%EC%B5%9C%EC%9E%AC%EC%9C%A0&key_locale=in(JaeyooChoy) 2009-11-06 Conferencefor EllipticandParabolicPDEs -Bifurcationfromtheessentialspectrumfornonlinearellipticproblems http://www mathnetorkr/new_sub04/sub04_01_01php? no=3679&ko_name=%EB%B3%80%EC%9E%AC%ED%98%95&paper_id=&key_name=%EB%B3%80%EC%9E%AC%ED%98%95&key_locale=in(ByeonJaeyoung) 2009-11-06 The13thInternationalWorkshoponDifferentialGeometryandRelatedFields -Homogeneous Foliations onNoncompactSymmetricSpacex http://www mathnetorkr/new_sub04/sub04_01_01php?no=4380&ko_name=Jurgen+Berndt&paper_id=&key_name=berndt&key_locale=out(Jurgen Berndt) 2009-11-06 Conferencefor EllipticandParabolicPDEs -Singularsolutions ofsemilinearellipticequations andthemethodofphaseplane(BaeSooHyun) 2009-11-06 Conferencefor EllipticandParabolicPDEs -Globalestimates forGreens matrices ofsecondorderellipticsystems http://www mathnetorkr/new_sub04/sub04_01_01php? no=4241&ko_name=%EA%B9%80%EC%84%B8%EC%9D%B5&paper_id=&key_name=%EA%B9%80%EC%84%B8%EC%9D%B5&key_locale=in(KimSeick) 2009-11-06 The13thInternationalWorkshoponDifferentialGeometryandRelatedFields -GeometryofBochnerCurvatureofKaehlerManifolds http://www mathnetorkr/new_sub04/sub04_01_01php?no=4381&ko_name=Mitsuhiro+Itoh&paper_id=&key_name=itoh&key_locale=out(MitsuhiroItoh) 2009-11-06 Conferencefor EllipticandParabolicPDEs -Anunexpectedconnectionbetweensmalldiffusionproblems andproblems withinfiniteboundaryvalues http://www mathnetorkr/new_sub04/sub04_01_01php?no=4434&ko_name=Edward+Norman+Dancer&paper_id=(EdwardDancer) 2009-11-06 : ( ) 2009-11-06 Conferencefor EllipticandParabolicPDEs -Vortexsolutions intheself-dualChern-Simons-Higgs theory(KwangseokChoe) 2009-11-05 Conferencefor EllipticandParabolicPDEs -Existenceandasymptotics oftopologicalsolutions intheself-dualMaxwell-Chern-Simons CP(1)model (HanJongmin) 2009-11-05 The13thInternationalWorkshoponDifferentialGeometryandRelatedFields -Homogeneous Foliations onNoncompactSymmetricSpacexIhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4380&ko_name=Jurgen+Berndt&paper_id=&key_name=berndt&key_locale=out(Jurgen Berndt) 2009-11-05 Conferencefor EllipticandParabolicPDEs -Blow-upofElectricFields betweenCloselySpacedSphericalPerfectConductors http://www mathnetorkr/new_sub04/sub04_01_01php? no=4320&ko_name=%EC%9E%84%EB%AF%B8%EA%B2%BD&paper_id=&key_name=%EC%9E%84%EB%AF%B8%EA%B2%BD&key_locale=in(LimMikyoung) 2009-11-05 The13thInternationalWorkshoponDifferentialGeometryandRelatedFields -IsoperimatricInequalityforFlatSurfaces http://www mathnetorkr/new_sub04/sub04_01_01php? no=1918&ko_name=%EC%B5%9C%EC%9E%AC%EA%B2%BD&paper_id=&key_name=%EC%B5%9C%EC%9E%AC%EA%B2%BD&key_locale=in(JaigyoungChoe) 2009-11-05 Conferencefor EllipticandParabolicPDEs -Progress ontheStrongEshelbys Conjecture(LeeHyundae) 2009-11-05 Conferencefor EllipticandParabolicPDEs -Bifurcationproperties ofHollingtypepredator-preysystems http://www mathnetorkr/new_sub04/sub04_01_01php? no=4001&ko_name=%EC%8B%AC%EC%84%B1%EC%95%84&paper_id=&key_name=%EC%8B%AC%EC%84%B1%EC%95%84&key_locale=in(ShimSeong-A) 2009-11-05 The13thInternationalWorkshoponDifferentialGeometryandRelatedFields -SecondEigenvalueofJacobiOperatorforHypersurfaces http://www mathnetorkr/new_sub04/sub04_01_01php?no=4379&ko_name=Wei%2C+Guoxin&paper_id=&key_name=wei&key_locale=out(GuoxinWei) 200911-05 Conferencefor EllipticandParabolicPDEs -ParabolicMethodforNonlinearEigenValueProblems http://www mathnetorkr/new_sub04/sub04_01_01php? no=3937&ko_name=%EC%9D%B4%EA%B8%B0%EC%95%94&paper_id=&key_name=%EC%9D%B4%EA%B8%B0%EC%95%94&key_locale=in(LeeKi-Ahm) 2009-11-05 Conferencefor EllipticandParabolicPDEs -Theconepropertyforparabolicpartialdifferentialequations http://www mathnetorkr/new_sub04/sub04_01_01php? no=2204&ko_name=%EA%B3%BD%EB%AF%BC%EA%B7%9C&paper_id=&key_name=%EA%B3%BD%EB%AF%BC%EA%B7%9C&key_locale=in(KwakMinkyu) 2009-11-05 The13thInternationalWorkshoponDifferentialGeometryandRelatedFields -HarmonicSpaces andFisherInformationGeometryofPoissonKernelhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4381&ko_name=Mitsuhiro+Itoh&paper_id=&key_name=itoh&key_locale=out(Mitsuhiro Itoh) 2009-11-05 Conferencefor EllipticandParabolicPDEs -GradientEstimates forEllipticandParabolicPDEs withMeasurableCoefficients inNonsmoothDomains http://www mathnetorkr/new_sub04/sub04_01_01php? no=730&ko_name=%EB%B3%80%EC%88%9C%EC%8B%9D&paper_id=&key_name=%EB%B3%80%EC%88%9C%EC%8B%9D&key_locale=in(Sun-SigByun) 2009-11-05 The13thInternationalWorkshoponDifferentialGeometryandRelatedFields -AlmosrHermitianandKaehlerStructures onProductManifolds (YoshiyukiWatavabe) 2009-11-05 Conferencefor EllipticandParabolicPDEs -Connectingorbits forasemilinearparabolicequationwithasupercriticalexponenthttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4441&ko_name=Eiji+Yanagida&paper_id=(EijiYanagida) 2009-11-05 2009 ( ) 2009-11-05 2009 -TheflavorofElNinoinachangingclimate( ) 2009-11-05 2009 ( ) 2009-11-05 2009 (Bioturbation) ( ) 2009-11-05 2009 ( ) 2009-11-05 2009 ( ) 2009-11-05 2009 ( ) 2009-11-05 2009 ( ) 2009-11-05 2009 ( ) 2009-11-05 2009 -TheroleofFUTUREAdvisoryPanelonStatus Outlooks Forecasts andEngagement(SOFE)( ) 2009-11-05 2009 - FUTURE ( ) 2009-11-05 2009 -AICE ( ) 2009-11-05 2009 -COVE ( ) 2009-11-05 2009 -FUTURE ( ) 2009-11-05 2009 (SeaIce) ( ) 2009-11-05 2009 -Two-LayerNumericalModelingofNear-InertialCurrentDecayintheNorthwestPacificunderTyphoonNari(SokKuhKang) 2009-11-05 2009 -PoSEIDON 2007 ~2009 ( ) 2009-11-05 2009 ( ) 2009-11-05 2009 ( ) 2009-11-05 2009 -PreliminaryresultofLagrangianproperties analyzedbyFinite-SizeLyapunovExponent(FSLE)techniqueintheEastSeaofKorea( ) 2009-11-05 2009 -SubmesoscalevariabilityinsummeralongsoutherncoastofKoreanearPusan(KioshiMishiro) 2009-11-05 2009 -Remotely-forcedwatertemperaturefluctuations offtheeastcoastofKorea(ChangBongCho) 2009-11-05 2009 ( ) 2009-11-05 2009 -Comparisonofwindandtidalcontributions toseasonalcirculationoftheYellow Sea(JaeHongMoon) 2009-11-05 2009 -FormationoftheabnormalCDW(ChangjiangDilutedWater)lens in1996( ) 2009-11-05 2009 -DailyVariationofVerticalHydrographicStructureataBuoyStationintheSouthernYellow Sea( ) 2009-11-05 2009 -Effects oftheChangjiangdilutedwaterontyphoon-inducedseasurfacecooling( ) 2009-11-05 2009 -SpatialandtemporalchangeofsensibleheatfluxaroundtheKoreancoastalwater( ) 2009-11-05 2009 -ResponseoftheChangjiangDilutedWatertoTyphoons intheEastChinaSea( ) 2009-11-05 2009 -MODIS LST SST ( ) 2009-11-05 2009 (SAR) ( ) 2009-11-05 2009 -AnEstimationofTyphoon-inducedSeaSurfaceColdWaterDispersionSpeedfromSatellite-observationSST(KiRyongKang) 2009-11-05 2009 ( ) 2009-11-05 2009 (TEOS-10) ( ) 2009-11-05 2009 Fragilidiumduplocampanaeforme ( ) 2009-11-05 2009 -InterannualvariabilityofspringbloomintheEastSeasince1998derivedfromsatelliteoceancolor(KeikoYamada) 2009-11-05 2009 ( ) 2009-11-05 2009 (HalophilanipponicaJ Kuo) ( ) 2009-11-05 2009 -A biologicaltoolusingciliatecommunityforevaluationofcoastalwaterquality( ) 2009-11-05 2009 -2009 ( ) 2009-11-05 2009 -Effects ofdredging-inducedoverflows onseawaterqualityandbacteriainthevicinityofsandextractionareaintheSouthSea Korea( ) 2009-11-05 2009 alkalinephosphatase ( ) 2009-11-05 2009 Dinophysis ( ) 2009-11-05 2009 (Euphausiapacifica) ( ) 2009-11-05 2009 ( ) 2009-11-05 2009 -2008 ( ) 2009-11-05 2009 -2008 ~2009 ( ) 2009-11-05 2009 ( ) 2009-11-05 2009 ( ) 2009-11-05 2009 ( ) 2009-11-05 2009 : ( ) 2009-11-05 2009 -2-D and3-D seismicinvestigationofseismicchimneys intheUlleungBasin(NyeonKeonKang) 2009-11-05 2009 -TheOkinawaTrough:A candidateforKorea-JapanjointIODP proposals (AyseGungor) 2009-11-05 2009 -BiogenicCaCO 3 andopalabundanceinthewesternandcentralequatorialPacificOceanduringthelateQuaternary( ) 2009-11-05 2009 - 120000 ( ) 2009-11-05 2009 -ParticlefluxvariationinducedbyshiftingITCZlocationinthe10˚N thermoclineridge( ) 2009-11-05 2009 -EvaluationofNd SrandPbisotopicratios ofdeepseasediments as dustsourceindicators inthenortheastPacific( ) 2009-11-05 2009 -High-resolutionseasurfacetemperaturerecords oftheeastcoastareaduringthelast2000years ( ) 2009-11-05 2009 PAHs ( ) 2009-11-05 2009 -Brominatedandchlorinatedcompounds intheblubbers offinless porpoise(Neophocaenaphocaenoides)fromKoreancoastalwaters ( ) 2009-11-05 2009 Si P ( ) 2009-11-05 2009 -Changes inmaximumSSToverthewarmpoolregionduringtheFutureGreenhouseWarming( ) 2009-11-05 ASARCSeminar -Freegroups inthesecondboundedcohomology (ParkHeeSook) 2009-11-03 ASARCSeminar -p-adic 2(HanRin) 2009-11-03 ASARCSeminar -Borcherds lifting 2http://www mathnetorkr/new_sub04/sub04_01_01php?no=4018&ko_name=%EC%B5%9C%EB%8F%84%ED%9B%88&paper_id=&key_name=%EC%B5%9C%EB%8F%84%ED%9B%88&key_locale=in(ChoiDoHoon) 2009-11-03 ASARCSeminar -p-adic 1(HanRin) 2009-11-02 ASARCSeminar -Borcherds lifting 1http://www mathnetorkr/new_sub04/sub04_01_01php?no=4018&ko_name=%EC%B5%9C%EB%8F%84%ED%9B%88&paper_id=&key_name=%EC%B5%9C%EB%8F%84%ED%9B%88&key_locale=in(ChoiDoHoon) 2009-11-02 2009 -TheOptimumDietaryCarbohydrate/LipidRatioCanSpareProteinIN GrowingBeluga HusoHuso( ) 2009-11-02 KAIST (2009 2 ) -Connectingthedots:How network-thinkingapplies tobiologyandmedicinehttp://www mathnetorkr/new_sub04/sub04_01_01php? no=4321&ko_name=%EA%B3%A0%EA%B4%91%EC%9D%BC&paper_id=&key_name=%EA%B3%A0%EA%B4%91%EC%9D%BC&key_locale=in(GohKwangil) 2009-10-30 KAIST DiscreteMathSeminar -TheBannai-ItoConjecturehttp://www mathnetorkr/new_sub04/sub04_01_01php?no=3646&ko_name=%EB%B0%A9%EC%84%B8%EC%A0%95&paper_id=&key_name=%EB%B0%A9%EC%84%B8%EC%A0%95&key_locale=in(BangSeJeong) 200910-30 KAIST (2009 2 ) -Kineticrelations forundercompressiveshocks Physical mathematical andnumericalissues http://www mathnetorkr/new_sub04/sub04_01_01php?no=4319&ko_name=LeFloch%2C+Philippe+G &paper_id=&key_name=LeFloch&key_locale=out(PhilippeG LeFloch) 2009-10-29 ASARCSeminar -Warings problem(LeeJoonHo) 2009-10-27 2009NIMSHotTopics WorkshoponKineticTheoryandFluidDynamics -L1-stabilityoftheVlasov-Poissonsysteminanacceleratingcosmologicalsetting(LeeHo) 2009-10-24 2009NIMSHotTopics WorkshoponKineticTheoryandFluidDynamics -A prioriestimates fortheweaksolutions tothespatiallyhomogeneous Boltzmannequation(ChoYongkum) 2009-10-24 2009NIMSHotTopics WorkshoponKineticTheoryandFluidDynamics -Asymptoticflockingdynamics fortheCucker-SmalemodelwithaRayleighfriction(KimJongHo) 2009-10-24 2009NIMSHotTopics WorkshoponKineticTheoryandFluidDynamics -Analignmentmodelfororientationalaggregationofinteractingbundles ofcells http://www mathnetorkr/new_sub04/sub04_01_01php? no=4178&ko_name=%EA%B0%95%EA%B2%BD%EA%B7%BC&paper_id=&key_locale=in(KangKyungkeun) 2009-10-24 2009NIMSHotTopics WorkshoponKineticTheoryandFluidDynamics -AxialGreens functionformulationfortheStokes flow (KimDowan) 2009-10-24 2009NIMSHotTopics WorkshoponKineticTheoryandFluidDynamics -Pointwisetime-asymptoticstabilityofaBoltzmannshockprofilehttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4337&ko_name=Yu%2C+Shih-Hsien&paper_id=&key_name=Yu&key_locale=out(Shih-Hsien Yu) 2009-10-24 2009NIMSHotTopics WorkshoponKineticTheoryandFluidDynamics -Asymptoticagreementofmoments andhigherordercontractionintheBurgers equationhttp://www mathnetorkr/new_sub04/sub04_01_01php? no=4112&ko_name=%EA%B9%80%EC%9A%A9%EC%A0%95&paper_id=&key_name=%EA%B9%80%EC%9A%A9%EC%A0%95&key_locale=in(KimYongJung) 2009-10-23 KIASSeminar -IntroductiontoNoncommutativeGeometry6http://www mathnetorkr/new_sub04/sub04_01_01php?no=4345&ko_name=Dmitry+Kaledin&paper_id=&key_name=Dmitry+Kaledin&key_locale=in(DmitryKaledin) 2009-10-23 2009NIMSHotTopics WorkshoponKineticTheoryandFluidDynamics -Gevreysmoothingeffectforthespatiallyhomogeneous Boltzmannequationwithoutangularcutoffhttp://www mathnetorkr/new_sub04/sub04_01_01php? no=4335&ko_name=Ukai%2C+Seiji&paper_id=&key_name=ukai&key_locale=out(SeijiUkai) 2009-10-23 KIASSeminar -IntroductiontoNoncommutativeGeometry5http://www mathnetorkr/new_sub04/sub04_01_01php?no=4345&ko_name=Dmitry+Kaledin&paper_id=&key_name=Dmitry+Kaledin&key_locale=in(DmitryKaledin) 2009-10-23 2009NIMSHotTopics WorkshoponKineticTheoryandFluidDynamics -Numericalsimulations ofcore-annularflows http://www mathnetorkr/new_sub04/sub04_01_01php?no=4187&ko_name=%EA%B0%95%EB%AA%85%EC%A3%BC&paper_id=&key_locale=in(KangMyungjoo) 200910-23 2009NIMSHotTopics WorkshoponKineticTheoryandFluidDynamics -Variationalprinciples fortravelingwaves ofreaction-diffusionequations http://www mathnetorkr/new_sub04/sub04_01_01php?no=4318&ko_name=Chiun-Chuan+Chen&paper_id=(ChiunChuanChen) 2009-10-23 2009NIMSHotTopics WorkshoponKineticTheoryandFluidDynamics -Kineticrelations forcompressiblefluids http://www mathnetorkr/new_sub04/sub04_01_01php?no=4319&ko_name=LeFloch%2C+Philippe+G &paper_id=&key_name=philippe&key_locale=out(PhilippeLeFloch) 2009-10-23 2009NIMSHotTopics WorkshoponKineticTheoryandFluidDynamics -Flow phenomenaingas circuitbreakerwithelectricarchttp://www mathnetorkr/new_sub04/sub04_01_01php? no=1949&ko_name=%EC%B5%9C%ED%9D%AC%EC%A4%80&paper_id=&key_name=%EC%B5%9C%ED%9D%AC%EC%A4%80&key_locale=in(ChoeHiJun) 2009-10-22 2009NIMSHotTopics WorkshoponKineticTheoryandFluidDynamics -DissipativeSystems http://www mathnetorkr/new_sub04/sub04_01_01php?no=4326&ko_name=Liu%2C+Tai-Ping&paper_id=&key_name=liu&key_locale=out(Tai-PingLiu) 2009-10-22 2009NIMSHotTopics WorkshoponKineticTheoryandFluidDynamics -KineticTheoryandFluidDynamics http://www mathnetorkr/new_sub04/sub04_01_01php?no=4328&ko_name=Markowich%2C+Peter+A &paper_id=&key_name=markowich&key_locale=out(PeterMarkowich) 2009-1022 2009NIMSHotTopics WorkshoponKineticTheoryandFluidDynamics -Asymptoticstabilityofstationarysolutions toheat-conductiveviscous gas inhalfspacehttp://www mathnetorkr/new_sub04/sub04_01_01php? no=4331&ko_name=Nishibata%2C+Shinya&paper_id=&key_name=nishibata&key_locale=out(ShinyaNishibata) 2009-10-22 2009NIMSHotTopics WorkshoponKineticTheoryandFluidDynamics -Singularperturbations forinteractingparticlesystems http://www mathnetorkr/new_sub04/sub04_01_01php?no=4317&ko_name=Slemrod%2C+Marshall&paper_id=&key_name=marshall&key_locale=out(Marshall Slemrod) 2009-10-22 InternationalworkshoponLiealgebras andrelatedtopics -Two-parameterquantumtoroidalalgebras viafinitegroups andtheMcKaycorrespondencehttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4439&ko_name=Nai+Huan+jing&paper_id=(NaihuanJing) 2009-10-22 2009NIMSHotTopics WorkshoponKineticTheoryandFluidDynamics -Onthefluid-dynamicsystemwiththeghosteffectofinfinitesimalcurvaturehttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4333&ko_name=Sone%2C+Yoshio&paper_id=&key_name=sone&key_locale=out(Yoshio Sone) 2009-10-22 InternationalworkshoponLiealgebras andrelatedtopics -Categorifyingquantumgroups (AaronLauda) 2009-10-22 2009NIMSHotTopics WorkshoponKineticTheoryandFluidDynamics -SymmetryofthelinearizedBoltzmannequationandtheOnsager-Casimirrelationhttp://www mathnetorkr/new_sub04/sub04_01_01php? no=4334&ko_name=Takata%2C+Shigeru&paper_id=&key_name=takata&key_locale=out(ShigeruTakata) 2009-10-22 2009NIMSHotTopics WorkshoponKineticTheoryandFluidDynamics -ClassificationandStabilityofMachComfigurationhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4338&ko_name=Chen%2C+Shuxing&paper_id=&key_name=chen&key_locale=out(ShuxingChen) 2009-10-22 InternationalworkshoponLiealgebras andrelatedtopics -AffineHeckealgebras oftypeBandD http://www mathnetorkr/new_sub04/sub04_01_01php?no=4713&ko_name=Vanessa+Miemietz&paper_id=(VanessaMiemietz) 2009-10-22 2009NIMSHotTopics WorkshoponKineticTheoryandFluidDynamics -Nonlinearstabilityofstrongrarefactionwaves fortherelaxationapproximationofconservationlaws inseveralspacedimensions withlargeinitialperturbationhttp://www mathnetorkr/new_sub04/sub04_01_01php? no=4339&ko_name=Zhao%2C+Hui+Jiang&paper_id=&key_name=zhao&key_locale=out(HuijiangZhao) 2009-10-22 2009NIMSHotTopics WorkshoponKineticTheoryandFluidDynamics -SymmetryofthelinearizedBoltzmannequationandits applications http://www mathnetorkr/new_sub04/sub04_01_01php?no=4334&ko_name=Takata%2C+Shigeru&paper_id=&key_name=takata&key_locale=out(Shigeru Takata) 2009-10-21 InternationalworkshoponLiealgebras andrelatedtopics -ReductionformulaeofLittlewood-Richardsoncoefficients http://www mathnetorkr/new_sub04/sub04_01_01php? no=1744&ko_name=%EC%A1%B0%EC%88%98%EC%A7%84&paper_id=&key_name=%EC%A1%B0%EC%88%98%EC%A7%84&key_locale=in(SoojinCho) 2009-10-21 InternationalworkshoponLiealgebras andrelatedtopics -Quivervarieties andpathrealizations associatedwithadjointcrystals (EuiyongPark) 2009-10-21 2009NIMSHotTopics WorkshoponKineticTheoryandFluidDynamics -QualitativeStudyoftheBoltzmannEquationhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4326&ko_name=Liu%2C+Tai-Ping&paper_id=&key_name=Liu&key_locale=out(Tai-PingLiu) 2009-10-21 InternationalworkshoponLiealgebras andrelatedtopics -Two-parameterquantumgroups andtherepresentationtheory:fromfinitetypes toaffinetypes http://www mathnetorkr/new_sub04/sub04_01_01php? no=4344&ko_name=Hu%2C+Nai+Hong&paper_id=&key_name=Hu&key_locale=out(NaihongHu) 2009-10-20 InternationalworkshoponLiealgebras andrelatedtopics -Onextremalweightcrystals oftypeA_{+infty} http://www mathnetorkr/new_sub04/sub04_01_01php? no=2249&ko_name=%EA%B6%8C%EC%9E%AC%ED%9B%88&paper_id=&key_name=%EA%B6%8C%EC%9E%AC%ED%9B%88&key_locale=in(KwonJaeHoon) 2009-10-20 InternationalworkshoponLiealgebras andrelatedtopics -Representations ofLiesuperalgebras inprimecharacteristichttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4442&ko_name=Weiqiang+Wang&paper_id=(WeiqiangWang) 2009-10-20 InternationalworkshoponLiealgebras andrelatedtopics -Irreduciblecharacters ofgenerallinearsuperalgebraandsuperdualityhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4341&ko_name=Cheng%2C+Shun-Jen&paper_id=&key_name=Shun-Jen&key_locale=out(Shun-Jen Cheng) 2009-10-20 InternationalworkshoponLiealgebras andrelatedtopics -HiddenGrassmannStructures inQuantumIntegrableModels http://www mathnetorkr/new_sub04/sub04_01_01php?no=4440&ko_name=Tetsuji+Miwa&paper_id=(TetsujiMiwa) 2009-10-20 InternationalworkshoponLiealgebras andrelatedtopics -Endotrivialmodules forfinitegroupschemes http://www mathnetorkr/new_sub04/sub04_01_01php?no=4340&ko_name=Carlson%2C+Jon+F &paper_id=&key_name=Carlson&key_locale=out(JonCarlson) 2009-10-20 InternationalworkshoponLiealgebras andrelatedtopics -Lietriplesystems andSteinbergunitaryLiealgebras ofranktwo http://www mathnetorkr/new_sub04/sub04_01_01php?no=4343&ko_name=Gao%2C+Yun&paper_id=&key_name=Yun&key_locale=out(YunGao) 2009-10-19 InternationalworkshoponLiealgebras andrelatedtopics -OntheGelfand-KirillovconjectureforsimpleLiealgebras http://www mathnetorkr/new_sub04/sub04_01_01php?no=2645&ko_name=Alexander+Premet&paper_id=Premet&key_name=Alexander&key_locale=out(AlexanderPremet) 200910-19 InternationalworkshoponLiealgebras andrelatedtopics -Gradingintegralandmodularrepresentationtheoryhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4346&ko_name=Parshall%2C+Brian&paper_id=(BrianParshall) 2009-10-19 InternationalworkshoponLiealgebras andrelatedtopics - DifferentiatingtheWeylgenericdimensionformulaandsupportvarieties forquantumgroups http://www mathnetorkr/new_sub04/sub04_01_01php?no=4443&ko_name=Daniel+K +Nakano&paper_id=(DanielK Nakano) 2009-10-19 2009NIMSHotTopics WorkshoponKineticTheoryandFluidDynamics -WignerMeasures http://www mathnetorkr/new_sub04/sub04_01_01php?no=4328&ko_name=Markowich%2C+Peter+A &paper_id=&key_name=Peter&key_locale=out(PeterMarkowich) 2009-10-19 2009NIMSHotTopics WorkshoponKineticTheoryandFluidDynamics -Ontransonicsteadycompressibleflows inanozzlehttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4336&ko_name=Xin%2C+Zhou+Ping&paper_id=&key_name=xin&key_locale=out(ZhoupingXin) 2009-10-19 KAIST (2009 2 ) -A heartmodelinthecirculatorysystemhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=3807&ko_name=%EC%A0%95%EC%9D%80%EC%98%A5&paper_id=&key_name=%EC%A0%95%EC%9D%80%EC%98%A5&key_locale=in(Jung Eunok) 2009-10-16 KIASSeminar -IntroductiontoNoncommutativeGeometry4http://www mathnetorkr/new_sub04/sub04_01_01php?no=4345&ko_name=Dmitry+Kaledin&paper_id=&key_name=Dmitry+Kaledin&key_locale=in(DmitryKaledin) 2009-10-15 KIASSeminar -IntroductiontoNoncommutativeGeometry3http://www mathnetorkr/new_sub04/sub04_01_01php?no=4345&ko_name=Dmitry+Kaledin&paper_id=&key_name=Dmitry+Kaledin&key_locale=in(DmitryKaledin) 2009-10-15 -MethodofSmallVolumeExpansions andApplications toMedicalImaginghttp://www mathnetorkr/new_sub04/sub04_01_01php? no=2161&ko_name=%EA%B0%95%ED%98%84%EB%B0%B0&paper_id=&key_name=%EA%B0%95%ED%98%84%EB%B0%B0&key_locale=in(KangHyeonbae) 2009-10-14 ASARCSeminar -Equivariantcohomologydetermines hypertoricmanifold (ShintaroKuroki) 2009-10-13 KAIST DiscreteMathSeminar -PerfectMatchings inClaw-freeCubicGraphs http://www mathnetorkr/new_sub04/sub04_01_01php?no=4229&ko_name=%EC%97%84%EC%83%81%EC%9D%BC&paper_id=&key_name=%EC%97%84%EC%83%81%EC%9D%BC&key_locale=in(Oum Sangil) 2009-10-09 KAIST (2009 2 ) -Compensatedcompactness andisometricembeddings http://www mathnetorkr/new_sub04/sub04_01_01php?no=4317&ko_name=Marshall+Slemrod&paper_id=&key_name=slemrod&key_locale=in(MarshallSlemrod) 2009-10-08 ASARCSeminar -Vectorbundles onasmoothquadricsurface (HuhSeokmoon) 2009-10-06 ASARCSeminar -Derivations andAutomorphisms onthealgebraofnoncommutativepowerseries http://www mathnetorkr/new_sub04/sub04_01_01php?no=4315&ko_name=Kentaro+Ihara&paper_id=&key_name=Ihara&key_locale=out(KentaroIhara) 2009-09-29 KAIST (2009 2 ) -ExperiencingLogicviaComputerhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=1691&ko_name=%EC%A0%95%EC%A3%BC%ED%9D%AC&paper_id=&key_name=%EC%A0%95%EC%A3%BC%ED%9D%AC&key_locale=in(Jeong Joohee) 2009-09-25 -Zeolites underpressure( ) 2009-09-25 Internationalworkshoponcombinatorialandgeometricapproachtorepresentationtheory -Highestweightcrystals forgeneralizedKac-Moodyalgebras http://www mathnetorkr/new_sub04/sub04_01_01php? no=2120&ko_name=%EA%B0%95%EC%84%9D%EC%A7%84&paper_id=&key_name=%EA%B0%95%EC%84%9D%EC%A7%84&key_locale=in(Kang SeokJin) 2009-09-24 Internationalworkshoponcombinatorialandgeometricapproachtorepresentationtheory -Affinesl(n)crystals andcylindricpartitions http://www mathnetorkr/new_sub04/sub04_01_01php?no=4310&ko_name=Peter+Tingley&paper_id=&key_name=Peter&key_locale=out(PeterTingley) 2009-09-23 Internationalworkshoponcombinatorialandgeometricapproachtorepresentationtheory -Applicationoftheperfectness ofKRcrystals http://www mathnetorkr/new_sub04/sub04_01_01php?no=4306&ko_name=Masato+Okado&paper_id=&key_name=Masato&key_locale=out(Masato Okado) 2009-09-23 Internationalworkshoponcombinatorialandgeometricapproachtorepresentationtheory -Affinecrystals fortypeEhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4305&ko_name=Anne+Schilling&paper_id=&key_name=Anne&key_locale=out(AnneSchilling) 2009-09-23 Internationalworkshoponcombinatorialandgeometricapproachtorepresentationtheory -K-theorySchubertcalculus oftheaffineGrassmannian http://www mathnetorkr/new_sub04/sub04_01_01php?no=4304&ko_name=Mark+Shimozono&paper_id=&key_name=Mark&key_locale=out(Mark Shimozono) 2009-09-23 Internationalworkshoponcombinatorialandgeometricapproachtorepresentationtheory -Ontensorcategoryarisingfromrepresentationtheoryoftherestrictedquantumuniversalenvelopingalgebraassociatedto$boldsymbol{mathfrak{sl}_2}$http://www mathnetorkr/new_sub04/sub04_01_01php? no=4303&ko_name=Yoshihisa+Saito&paper_id=&key_name=Saito&key_locale=out(YoshihisaSaito) 2009-09-23 Internationalworkshoponcombinatorialandgeometricapproachtorepresentationtheory -Gradedrepresentationtheoryofsymmetricgroups andrelatedHeckealgebras http://www mathnetorkr/new_sub04/sub04_01_01php?no=2669&ko_name=Alexander+Kleshchev&paper_id=Kleshchev(Alexander Kleshchev) 2009-09-22 ASARCSeminar -Compactmodulispaceofcommutingnilpotents http://www mathnetorkr/new_sub04/sub04_01_01php?no=4314&ko_name=%ED%98%84%EB%8F%99%ED%9B%88&paper_id=&key_name=%ED%98%84%EB%8F%99%ED%9B%88&key_locale=in(Hyeon Donghoon) 2009-09-22 Internationalworkshoponcombinatorialandgeometricapproachtorepresentationtheory -OnKhovanov-Laudaalgebras http://www mathnetorkr/new_sub04/sub04_01_01php?no=4302&ko_name=Monica+Vazirani&paper_id=&key_name=Monica&key_locale=out(MonicaVazirani) 2009-09-22 Internationalworkshoponcombinatorialandgeometricapproachtorepresentationtheory -A doubleHallapproachtoaffinequantumSchur-Weyltheoryhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4301&ko_name=Jie+Du&paper_id=&key_name=Du&key_locale=out(JieDu) 200909-22 Internationalworkshoponcombinatorialandgeometricapproachtorepresentationtheory -UniversalVermamodules andtranslationhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=2457&ko_name=Arun+Ram&paper_id=Ram&key_name=Ram&key_locale=out(ArunRam) 2009-09-22 Internationalworkshoponcombinatorialandgeometricapproachtorepresentationtheory -Equivariantmapalgebras http://www mathnetorkr/new_sub04/sub04_01_01php?no=4300&ko_name=Alistair+Savage&paper_id=&key_name=Savage&key_locale=out(AlistairSavage) 2009-09-21 Internationalworkshoponcombinatorialandgeometricapproachtorepresentationtheory -PolytopalestimateofMirkovic-Vilonenpolytopes lyinginaDemazurecrystalhttp://www mathnetorkr/new_sub04/sub04_01_01php? no=4299&ko_name=Satoshi+Naito&paper_id=&key_name=Naito&key_locale=out(SatoshiNaito) 2009-09-21 Internationalworkshoponcombinatorialandgeometricapproachtorepresentationtheory -Mirkovic-Vilonenpolytopes lyinginaDemazurecrystalandanop-positeDemazurecrystalhttp://www mathnetorkr/new_sub04/sub04_01_01php? no=4298&ko_name=Daisuke+Sagaki&paper_id=&key_name=Sagaki&key_locale=out(DaisukeSagaki) 2009-09-21 Internationalworkshoponcombinatorialandgeometricapproachtorepresentationtheory -AdmissiblePictures andLittlewood-RichardsonCrystals http://www mathnetorkr/new_sub04/sub04_01_01php? no=4297&ko_name=Toshiki+Nakashima&paper_id=&key_name=Nakashima&key_locale=out(ToshikiNakashima) 2009-09-21 Internationalworkshoponcombinatorialandgeometricapproachtorepresentationtheory -Weylmodules:acategoricalapproachhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4296&ko_name=Vyjayanthi+Chari&paper_id=&key_name=Chari&key_locale=out(VyjayanthiChari) 2009-0921 KAIST (2009 2 ) -Compressivesensingforbiomedicalimagingapplications http://www mathnetorkr/new_sub04/sub04_01_01php? no=4307&ko_name=%EC%98%88%EC%A2%85%EC%B2%A0&paper_id=&key_name=%EC%98%88%EC%A2%85%EC%B2%A0&key_locale=in(YeJongchul) 2009-09-18 -Predictionofphysicalproperties fromX-raybasalpeakprofiles (includingbriefintroductionoftheroleofclaymineralogists inoetroleumgeology)( ) 2009-09-18 Lectures onBasicAlgebraicGeometrybyMiles Reid(WCU project) -BasicAlgebraicGeometry27http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2009-09-15 Lectures onBasicAlgebraicGeometrybyMiles Reid(WCU project) -BasicAlgebraicGeometry28http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2009-09-15 ASARCSeminar -IntroductiontohigherChow groups :ananalogueofsingularhomologyforalgebraicvarieties http://www mathnetorkr/new_sub04/sub04_01_01php? no=4295&ko_name=%EB%B0%95%EC%A7%84%ED%98%84&paper_id=&key_name=%EB%B0%95%EC%A7%84%ED%98%84&key_locale=in(ParkJinhyun) 2009-09-15 Lectures onBasicAlgebraicGeometrybyMiles Reid(WCU project) -BasicAlgebraicGeometry25http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2009-09-12 Lectures onBasicAlgebraicGeometrybyMiles Reid(WCU project) -BasicAlgebraicGeometry26http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2009-09-12 ASARCSeminar -ThediscreteFrechetdistancewithimpreciseinputhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4285&ko_name=%EC%95%88%ED%9D%AC%EA%B0%91&paper_id=&key_name=%EC%95%88%ED%9D%AC%EA%B0%91&key_locale=in(Ahn HeeKap) 2009-09-11 WorkshoponComplexGeometry -Arakelov(in)equalities http://www mathnetorkr/new_sub04/sub04_01_01php?no=4294&ko_name=Eckart+Viehweg&paper_id=&key_name=Eckart&key_locale=out(EckartViehweg) 2009-09-11 WorkshoponComplexGeometry -Modulispaces ofstablequasimaps http://www mathnetorkr/new_sub04/sub04_01_01php?no=2339&ko_name=%EA%B9%80%EB%B2%94%EC%8B%9D&paper_id=&key_name=%EA%B9%80%EB%B2%94%EC%8B%9D&key_locale=in(Bumsig Kim) 2009-09-11 KAIST (2009 2 ) -Studyofgraphs viabraidgroups http://www mathnetorkr/new_sub04/sub04_01_01php?no=2177&ko_name=%EA%B3%A0%EA%B8%B0%ED%98%95&paper_id=&key_name=%EA%B3%A0%EA%B8%B0%ED%98%95&key_locale=in(Ko KyHyoung) 2009-09-10 WorkshoponComplexGeometry -JumpingofthenefconeforFanovarieties http://www mathnetorkr/new_sub04/sub04_01_01php?no=4293&ko_name=Burt+Totaro&paper_id=&key_name=Totaro&key_locale=out(BurtTotaro) 2009-09-10 WorkshoponComplexGeometry -Algebraicsurfaces andhyperbolicgeometryhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4293&ko_name=Burt+Totaro&paper_id=&key_name=Totaro&key_locale=out(BurtTotaro) 2009-09-10 WorkshoponComplexGeometry -Introductiontothelogminimalmodelprogramhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4292&ko_name=Osamu+Fujino&paper_id=&key_name=Osamu&key_locale=out(OsamuFujino) 2009-09-10 Lectures onBasicAlgebraicGeometrybyMiles Reid(WCU project) -BasicAlgebraicGeometry23http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2009-09-09 Lectures onBasicAlgebraicGeometrybyMiles Reid(WCU project) -BasicAlgebraicGeometry24http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=(Miles Reid) 2009-09-09 WorkshoponComplexGeometry -Thebirationalgeometryofmodulispaces ofcurves withlevelstructurehttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4291&ko_name=Gavril+Farkas&paper_id=&key_name=Farkas&key_locale=out(GavrilFarkas) 2009-09-09 WorkshoponComplexGeometry -Stratifiedbundles and etalefundamentalgrouphttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4287&ko_name=H%C3%A9l%C3%A8ne+Esnault&paper_id=&key_name=Esnault&key_locale=out(HeleneEsnault) 2009-09-08 WorkshoponComplexGeometry -Overview onvarious fundamentalgroups http://www mathnetorkr/new_sub04/sub04_01_01php?no=4287&ko_name=H%C3%A9l%C3%A8ne+Esnault&paper_id=&key_name=Esnault&key_locale=out(HeleneEsnault) 2009-09-08 WorkshoponComplexGeometry -Modulispaceofcubicfourfolds http://www mathnetorkr/new_sub04/sub04_01_01php?no=4290&ko_name=Radu+Laza&paper_id=&key_name=Laza&key_locale=out(RaduLaza) 2009-09-08 WorkshoponComplexGeometry -Modulispaces birationaltomodularvarieties oforthogonalandunitarytypehttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4290&ko_name=Radu+Laza&paper_id=&key_name=Laza&key_locale=out(RaduLaza) 2009-09-08 WorkshoponComplexGeometry -TopologyoftheHitchinfibrationhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4289&ko_name=Luca+Migliorini&paper_id=&key_name=Luca&key_locale=out(LucaMigliorini) 2009-09-07 WorkshoponComplexGeometry -Algebraicmaps andHodgetheoryhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4289&ko_name=Luca+Migliorini&paper_id=&key_name=Luca&key_locale=out(LucaMigliorini) 2009-09-07 WorkshoponComplexGeometry -Completemoduliofpairs combinatorialaspects http://www mathnetorkr/new_sub04/sub04_01_01php?no=4288&ko_name=Valery+Alexeev&paper_id=&key_name=Alexeev&key_locale=out(ValeryAlexeev) 2009-09-07 KAIST -Anextendedfiniteelementbasedtopologyoptimizationfornano-scaleheattransfer(LeePilhwa) 2009-09-02 ASARCSeminar -Canonicaldeloopingmachine(JeongGyuRak) 2009-09-01 KAIST -Theimmersedboundarymethodforadvection-electrodiffusionwithimplicittimesteppingandlocalmeshrefinement(LeePilhwa) 2009-08-31 Lectures onBasicAlgebraicGeometrybyMiles Reid(WCU project) -BasicAlgebraicGeometry21http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=&key_locale=outtarget=new(Miles Reid) 2009-08-29 Lectures onBasicAlgebraicGeometrybyMiles Reid(WCU project) -BasicAlgebraicGeometry22http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=&key_locale=outtarget=new(Miles Reid) 2009-08-29 Lectures onBasicAlgebraicGeometrybyMiles Reid(WCU project) -BasicAlgebraicGeometry19http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=&key_name=Miles&key_locale=out(Miles Reid) 2009-08-27 Lectures onBasicAlgebraicGeometrybyMiles Reid(WCU project) -BasicAlgebraicGeometry20http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=&key_locale=outtarget=new(Miles Reid) 2009-08-27 10thInternationalCongress onMedicalandAppliedMalacology -BivalvemolluscanbiogeographyoftheEast/JapanSea(KonstantinA Lutaenko) 2009-08-26 10thInternationalCongress onMedicalandAppliedMalacology -Thefutureofbiodiversity(JohnB Burch) 2009-08-26 10thInternationalCongress onMedicalandAppliedMalacology -Currentstatus andprospectofshellfishcultureinRepublicofKorea(YoungJePark) 2009-08-26 10thInternationalCongress onMedicalandAppliedMalacology -GeneralprofileofreproductionandrecruitmentofasariclaminTokyoBay Japan(MitsuharuTOBA) 2009-08-26 10thInternationalCongress onMedicalandAppliedMalacology -ThebivalveLaternulaellipticaas asentinelorganismforenvironmentalmonitoringintheAntarcticcoastalwaters (InYoungAhn) 2009-08-26 10thInternationalCongress onMedicalandAppliedMalacology -FertilizingMolluscs aregenotypicallyhermaphroditic:aHypothesis (orfantasy)(WilliamH Heard) 2009-08-26 10thInternationalCongress onMedicalandAppliedMalacology -Growthandseasonalenergetics oftheascidianStyelaclavainJindongbay Korea(ChangKeunKang) 2009-08-26 10thInternationalCongress onMedicalandAppliedMalacology -Studyofcorrelationbetweenorganics andmineralinoystershellformation(SeungWooLee) 2009-08-26 10thInternationalCongress onMedicalandAppliedMalacology -Effects ofwatercurrentontheearlynurserylifeofhatcheryJapanesescallopPatinopectenyessoensis (QtaeJo) 2009-08-26 10thInternationalCongress onMedicalandAppliedMalacology -Somenew dataonreproductiveinterrelations betweencyprinidfishes (cyprinidae:acheilognathinae gobioninae)andfreshwaterbivalves (unionidae)intheamurriver Russia(ElenaM Sayenko) 2009-08-26 10thInternationalCongress onMedicalandAppliedMalacology -Biologicalenvironmentalcharacteristics inhabitatofanabaloneHaliotis diversicolorintheeasterncoastalwaters ofJejuisland Korea(JoonTaEkYoo) 2009-08-26 10thInternationalCongress onMedicalandAppliedMalacology -Ontogeneticnicheshifts ofabaloneHaliotis discus hannaiinrelationwithpopulationdynamics (NamIlWon) 2009-08-26 10thInternationalCongress onMedicalandAppliedMalacology -GrowthandSurvivaloftheFreshwaterPearlMusselChamberlainiahainesiana(Lea 1856)fromJuveniletoAdultRearedinDifferentSites andDensities (UthaiwanKovitvadhi) 2009-08-26 10thInternationalCongress onMedicalandAppliedMalacology -FreshwatermalacofaunaofthelakeBaikalregion:biodiversity originandconnections withadjacentfaunas ofsiberia mongoliaandsouthernRussianfar(ProzorovaLarisaA) 2009-08-26 10thInternationalCongress onMedicalandAppliedMalacology -SeashellFoodCultureRelatedtoMolluskBiodiversityinKoreanCoasts andIslands (JongGeelJe) 2009-08-26 10thInternationalCongress onMedicalandAppliedMalacology -TheMolluscanDiversityandMalacofaunaDatabaseinTaiwan(WenLungWu) 2009-08-26 10thInternationalCongress onMedicalandAppliedMalacology -TheMollusks ofSeogundo JejuIsland SouthKorea(RonaldG Noseworthy) 2009-08-26 10thInternationalCongress onMedicalandAppliedMalacology -UltrastructuralStudies ofVitellogenesis inOocytes andOocyteDegenerationAssociatedwithFollicleCells inFemaleSinonovaculaconstricta(Bivalvia:Pharidae)inWesternKorea(EeYungChung) 2009-08-26 10thInternationalCongress onMedicalandAppliedMalacology -Reproductivebehaviourofsydneyrockoysters saccostreaglomerata slectedforfastergrowth(MichaelC Dove) 2009-08-26 Lectures onBasicAlgebraicGeometrybyMiles Reid(WCU project) -BasicAlgebraicGeometry17http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=&key_locale=out(Miles Reid) 2009-08-25 Lectures onBasicAlgebraicGeometrybyMiles Reid(WCU project) -BasicAlgebraicGeometry18http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=&key_locale=out(Miles Reid) 2009-08-25 2009Combinatorics Workshop -Reflexivegraphs admittingsemilatticepolymorphisms acharacterisationhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4283&ko_name=Mark+H +Siggers&paper_id=&key_name=Mark&key_locale=in(MarkSiggers) 2009-08-21 2009Combinatorics Workshop -Bi-resolvinggraphhomomorphisms andapplicationtosymbolicdynamics (JungUijin) 2009-08-21 2009Combinatorics Workshop -Regularmatrices andtheirpreservers oversemirings http://www mathnetorkr/new_sub04/sub04_01_01php? no=810&ko_name=%EC%86%A1%EC%84%9D%EC%A4%80&paper_id=&key_name=%EC%86%A1%EC%84%9D%EC%A4%80&key_locale=in(Songseokzun) 2009-08-21 2009Combinatorics Workshop -Finitetypeinvariants andn-equivalenceofgraphs (JeongMyeongju) 2009-08-21 2009Combinatorics Workshop -m-pseudoinvolutions (KimHana) 2009-08-21 2009Combinatorics Workshop -Symmetryandsuper-symmetrydistributionforpartitions (ShinHeesung) 2009-08-21 2009Combinatorics Workshop -Countingderangements withascents anddescents ingivenpositions (SeoSeunghyun) 2009-08-21 2009Combinatorics Workshop -TheRankofSkew-symmetricRandomMatrices overFiniteFields (LeeJoonkyung) 2009-08-21 2009Combinatorics Workshop -Onsphericaldualwidth(ShoSuda) 2009-08-21 2009Combinatorics Workshop -Graphs withmany$\pm$1or$\pm$$2\surd$eigenvalues (EbrahimGhorbani) 2009-08-21 2009Combinatorics Workshop -GeometricDistance-RegularGraphs withSmallestEigenvalue−3 (BangSejeong) 2009-08-21 2009Combinatorics Workshop -Transitive-ClosureSpannerofDirectedGraphs (JungKyomin) 2009-08-21 2009Combinatorics Workshop -Completedescriptionofearlygiantcomponets inrandomgraphs G(np)(KimJeongHan) 2009-08-21 2009Combinatorics Workshop -Someopenproblems oncriticalgraphs http://www mathnetorkr/new_sub04/sub04_01_01php?no=4282&ko_name=Tommy+R+Jensen&paper_id=&key_name=tommy&key_locale=in(TommyR Jensen) 2009-08-20 2009Combinatorics Workshop -Oncalculations ofthenumberoflonesummatrices (LeeJoonYop) 2009-08-20 2009Combinatorics Workshop -FiverGames onToruses (ParkBoram) 2009-08-20 2009Combinatorics Workshop -A characterizationofTaylorgraphs (ParkJongyook) 2009-08-20 2009Combinatorics Workshop -Blobs blocks andorhercyclicelements http://www mathnetorkr/new_sub04/sub04_01_01php?no=4451&ko_name=Koolen%2C+Jacobus+Hend&paper_id=(Jacobus H Koolen) 2009-08-20 2009Combinatorics Workshop -Classificationofregularembeddings ofacartesianpowerofagraph(KwonYoungsoo) 2009-08-20 2009Combinatorics Workshop -Combinatorialgeometryandgeometrictransversals http://www mathnetorkr/new_sub04/sub04_01_01php?no=4281&ko_name=Andreas+Holmsen&paper_id=&key_locale=out(Andreas Holmsen) 2009-08-20 2009Combinatorics Workshop -Competitiongraphandits variants http://www mathnetorkr/new_sub04/sub04_01_01php?no=50&ko_name=%EA%B9%80%EC%84%9C%EB%A0%B9&paper_id=&key_name=%EA%B9%80%EC%84%9C%EB%A0%B9&key_locale=in(Kim Suhryung) 2009-08-20 2 TopologyWorkshop -Volumes ofhyperboliccone-manifolds ofknot6_1(HamJiyoung) 2009-08-19 2 TopologyWorkshop -Reidemeistertorsionandhomologycylinders II(KimTaehee) 2009-08-19 2 TopologyWorkshop -Reidemeistertorsionandhomologycylinders I(KimTaehee) 2009-08-19 2 TopologyWorkshop -Problems inextendedhyperbolicspaceIhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4011&ko_name=%EC%A1%B0%EC%9C%A4%ED%9D%AC&paper_id=&key_name=%EC%A1%B0%EC%9C%A4%ED%9D%AC&key_locale=in(Cho Yunhi) 2009-08-19 2 TopologyWorkshop -Kashaevs volumeconjecture(ChoJinSeok) 2009-08-19 2 TopologyWorkshop -Kashaevinvariant(ChoJinSeok) 2009-08-19 2 TopologyWorkshop -Botttowers andcohomologicalrigidityIIhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=742&ko_name=%EC%84%9C%EB%8F%99%EC%97%BD&paper_id=&key_name=%EC%84%9C%EB%8F%99%EC%97%BD&key_locale=in(Suh DongYup) 2009-08-18 2 TopologyWorkshop -Derived(orHomotopy)categories andderivedfactors II(JeongGyuRak) 2009-08-18 2 TopologyWorkshop -AveragingformulaforNielsennumbers IIhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=1407&ko_name=%EC%9D%B4%EC%A2%85%EB%B2%94&paper_id=&key_name=%EC%9D%B4%EC%A2%85%EB%B2%94&key_locale=in(Lee JongBum) 2009-08-18 2 TopologyWorkshop -Finitelydominatedspaces andprojectivemodules II(JoJangHyun) 2009-08-17 2 TopologyWorkshop -Finitelydominatedspaces andprojectivemodules I(JoJangHyun) 2009-08-17 2 TopologyWorkshop -Derived(orHomotopy)categories andderivedfunctors I(JeongGyuRak) 2009-08-17 2 TopologyWorkshop -AveragingformulaforNielsennumbers Ihttp://www mathnetorkr/new_sub04/sub04_01_01php?no=1407&ko_name=%EC%9D%B4%EC%A2%85%EB%B2%94&paper_id=&key_name=%EC%9D%B4%EC%A2%85%EB%B2%94&key_locale=in(Lee JongBum) 2009-08-17 2 TopologyWorkshop -Botttowers andcohomologicalrigidityIhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=742&ko_name=%EC%84%9C%EB%8F%99%EC%97%BD&paper_id=&key_name=%EC%84%9C%EB%8F%99%EC%97%BD&key_locale=in(Suh DongYup) 2009-08-17 Lectures onBasicAlgebraicGeometrybyMiles Reid(WCU project) -BasicAlgebraicGeometry15http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=&key_locale=out(Miles Reid) 2009-08-13 Lectures onBasicAlgebraicGeometrybyMiles Reid(WCU project) -BasicAlgebraicGeometry16http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=&key_locale=out(Miles Reid) 2009-08-13 Lectures onBasicAlgebraicGeometrybyMiles Reid(WCU project) -BasicAlgebraicGeometry13http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=&key_locale=out(Miles Reid) 2009-08-11 Lectures onBasicAlgebraicGeometrybyMiles Reid(WCU project) -BasicAlgebraicGeometry14http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=&key_locale=out(Miles Reid) 2009-08-11 ASARCSeminar -p-adicHodgetheory3/3:Comparisonisomorphisms (etalecohomologyvs crystallinecohomology)(KazumaMorita) 2009-08-05 DepartmentofMathematicalSciences Seminar KAIST -Onthefifth-orderKdV equationhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4278&ko_name=%EA%B6%8C%EC%88%9C%EC%8B%9D&paper_id=&key_locale=in(SoonsikKwon) 2009-08-05 DepartmentofMathematicalSciences Seminar KAIST -Scatteringproblems ofcanonicaldispersiveequations http://www mathnetorkr/new_sub04/sub04_01_01php?no=4278&ko_name=%EA%B6%8C%EC%88%9C%EC%8B%9D&paper_id=&key_locale=in(SoonsikKwon) 2009-08-05 ASARCSeminar -Varieties ofalmostminimaldegree-Applications andProblems http://www mathnetorkr/new_sub04/sub04_01_01php?no=4277&ko_name=Peter+Schenzel&paper_id=&key_locale=out(PeterSchenzel) 2009-08-04 ASARCSeminar -p-adicHodgetheory2/3:Fontainerings andbasicfacts ofp-adicrepresentations (KazumaMorita) 2009-08-04 ASARCSeminar -p-adicHodgetheory1/3:l-adicrepresentations vs p-adicrepresentations (KazumaMorita) 2009-08-04 TheMagicofMathematics inInformationTechnology -SearchingforSpectrumEfficiencyhttp://www stanfordedu/~apaulraj/(ArogyaswamiPaulraj) 2009-08-03 TheMagicofMathematics inInformationTechnology -FromRadiativeTransferTheorytoFastAlgorithms forCellPhones http://www mathnetorkr/new_sub04/sub04_01_01php?no=4286&ko_name=Thomas+Kailath&paper_id=&key_name=Thomas&key_locale=out(Thomas Kailath) 2009-08-03 Lectures onBasicAlgebraicGeometrybyMiles Reid(WCU project) -BasicAlgebraicGeometry11http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=&key_locale=out(Miles Reid) 2009-07-30 Lectures onBasicAlgebraicGeometrybyMiles Reid(WCU project) -BasicAlgebraicGeometry12http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=&key_locale=out(Miles Reid) 2009-07-30 ASARCSeminar -Modularforms andGalois representations (SugWooShin) 2009-07-28 Lectures onBasicAlgebraicGeometrybyMiles Reid(WCU project) -BasicAlgebraicGeometry9http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=&key_locale=out(Miles Reid) 2009-07-28 Lectures onBasicAlgebraicGeometrybyMiles Reid(WCU project) -BasicAlgebraicGeometry10http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=&key_locale=out(Miles Reid) 2009-07-28 ASARCSeminar -HochschildHomologyofSheaves viaFibredCategories http://www mathnetorkr/new_sub04/sub04_01_01php?no=4271&ko_name=Abhishek+Banerjee&paper_id=&key_locale=out(AbhishekBanerjee) 2009-07-27 2009Knots andLow-dimensionalManifolds -Incompressiblesurfaces in2-bridgeknotcomplements 3http://www mathnetorkr/new_sub04/sub04_01_01php? no=3945&ko_name=%EC%98%A4%EC%8A%B9%EC%83%81&paper_id=&key_name=%EC%98%A4%EC%8A%B9%EC%83%81&key_locale=in(OhSeungsang) 2009-07-23 ASARCSeminar -BivariantChow groups andMotivicFiltrations (2/2)http://www mathnetorkr/new_sub04/sub04_01_01php?no=4271&ko_name=Abhishek+Banerjee&paper_id=&key_locale=out(AbhishekBanerjee) 2009-07-23 2009Knots andLow-dimensionalManifolds -Knotconcordance2http://www mathnetorkr/new_sub04/sub04_01_01php?no=90&ko_name=%EA%B9%80%EC%84%B8%EA%B5%AC&paper_id=&key_name=%EA%B9%80%EC%84%B8%EA%B5%AC&key_locale=in(Kim SeGoo) 2009-07-23 2009Knots andLow-dimensionalManifolds -Incompressiblesurfaces in2-bridgeknotcomplements 2http://www mathnetorkr/new_sub04/sub04_01_01php? no=3945&ko_name=%EC%98%A4%EC%8A%B9%EC%83%81&paper_id=&key_name=%EC%98%A4%EC%8A%B9%EC%83%81&key_locale=in(OhSeungsang) 2009-07-22 2009Knots andLow-dimensionalManifolds -A shortproofofBings characterizationofS3(NohSungJong) 2009-07-22 2009Knots andLow-dimensionalManifolds -Thinpositionforknots 2http://www mathnetorkr/new_sub04/sub04_01_01php?no=4270&ko_name=%EC%9D%B4%EC%83%81%EC%97%BD&paper_id=&key_name=%EC%9D%B4%EC%83%81%EC%97%BD&key_locale=in(Lee Sangyop) 2009-07-21 ASARCSeminar -BivariantChow groups andMotivicFiltrations (1/2)http://www mathnetorkr/new_sub04/sub04_01_01php?no=4271&ko_name=Abhishek+Banerjee&paper_id=&key_locale=out(AbhishekBanerjee) 2009-07-21 2009Knots andLow-dimensionalManifolds -Incompressiblesurfaces in2-bridgeknotcomplements 1http://www mathnetorkr/new_sub04/sub04_01_01php? no=3945&ko_name=%EC%98%A4%EC%8A%B9%EC%83%81&paper_id=&key_name=%EC%98%A4%EC%8A%B9%EC%83%81&key_locale=in(OhSeungsang) 2009-07-21 Lectures onBasicAlgebraicGeometrybyMiles Reid(WCU project) -BasicAlgebraicGeometry7http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=&key_locale=out(Miles Reid) 2009-07-21 Lectures onBasicAlgebraicGeometrybyMiles Reid(WCU project) -BasicAlgebraicGeometry8http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=&key_locale=out(Miles Reid) 2009-07-21 2009Knots andLow-dimensionalManifolds -Knotconcordance1http://www mathnetorkr/new_sub04/sub04_01_01php?no=90&ko_name=%EA%B9%80%EC%84%B8%EA%B5%AC&paper_id=&key_name=%EA%B9%80%EC%84%B8%EA%B5%AC&key_locale=in(Kim SeGoo) 2009-07-21 2009Knots andLow-dimensionalManifolds -Polygonindexandsuperbridgeindexofknots http://www mathnetorkr/new_sub04/sub04_01_01php? no=1818&ko_name=%EC%A7%84%EA%B5%90%ED%83%9D&paper_id=&key_name=%EC%A7%84%EA%B5%90%ED%83%9D&key_locale=in(JinGyoTaek) 2009-07-20 2009Knots andLow-dimensionalManifolds -Thinpositionforknots 1http://www mathnetorkr/new_sub04/sub04_01_01php?no=4270&ko_name=%EC%9D%B4%EC%83%81%EC%97%BD&paper_id=&key_name=%EC%9D%B4%EC%83%81%EC%97%BD&key_locale=in(Lee Sangyop) 2009-07-20 2009Knots andLow-dimensionalManifolds -Heegaardsplittings of3-manifolds http://www mathnetorkr/new_sub04/sub04_01_01php? no=3707&ko_name=%EC%9D%B4%EC%A0%95%ED%9B%88&paper_id=&key_name=%EC%9D%B4%EC%A0%95%ED%9B%88&key_locale=in(LeeJungHoon) 2009-07-20 Lectures onBasicAlgebraicGeometrybyMiles Reid(WCU project) -BasicAlgebraicGeometry6http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=&key_locale=out(Miles Reid) 2009-07-16 Lectures onBasicAlgebraicGeometrybyMiles Reid(WCU project) -BasicAlgebraicGeometry5http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=&key_locale=out(Miles Reid) 2009-07-16 Lectures onBasicAlgebraicGeometrybyMiles Reid(WCU project) -BasicAlgebraicGeometry4http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=&key_name=Miles&key_locale=out(Miles Reid) 2009-07-14 Lectures onBasicAlgebraicGeometrybyMiles Reid(WCU project) -BasicAlgebraicGeometry3http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=&key_name=Miles&key_locale=out(Miles Reid) 2009-07-14 ASARCSeminar -Genus fields ofrealbiquadraticfields http://www mathnetorkr/new_sub04/sub04_01_01php?no=4272&ko_name=Qin+Yue&paper_id=&key_locale=out(QinYue) 2009-07-10 ASARCSeminar -Modularforms ofweightoneproducedfromGalois representations http://www mathnetorkr/new_sub04/sub04_01_01php?no=4273&ko_name=Linsheng+Yin&paper_id=&key_locale=out(LinshengYin) 2009-07-10 ASARCSeminar -A Noteonglobalunits andlocalunits offunctionfields http://www mathnetorkr/new_sub04/sub04_01_01php?no=4274&ko_name=Su+Hu&paper_id=&key_name=Su+Hu&key_locale=out(SuHu) 2009-07-09 Lectures onBasicAlgebraicGeometrybyMiles Reid(WCU project) -BasicAlgebraicGeometry2http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=&key_name=Miles&key_locale=out(Miles Reid) 2009-07-09 Lectures onBasicAlgebraicGeometrybyMiles Reid(WCU project) -BasicAlgebraicGeometry1http://www mathnetorkr/new_sub04/sub04_01_01php?no=4269&ko_name=Miles+Reid&paper_id=&key_name=Miles&key_locale=out(Miles Reid) 2009-07-09 KIASSeminar -Introductiontosphericalvarieties anddescriptionofsomeparticularclasses ofsphericalvarieties 8http://www mathnetorkr/new_sub04/sub04_01_01php?no=4275&ko_name=Boris+Pasquier&paper_id=&key_locale=out(Boris Pasquier) 2009-07-02 KIASSeminar -Introductiontosphericalvarieties anddescriptionofsomeparticularclasses ofsphericalvarieties 7http://www mathnetorkr/new_sub04/sub04_01_01php?no=4275&ko_name=Boris+Pasquier&paper_id=&key_locale=out(Boris Pasquier) 2009-07-02 KIASSeminar -Introductiontosphericalvarieties anddescriptionofsomeparticularclasses ofsphericalvarieties 5http://www mathnetorkr/new_sub04/sub04_01_01php?no=4275&ko_name=Boris+Pasquier&paper_id=&key_locale=out(Boris Pasquier) 2009-07-01 KIASSeminar -Introductiontosphericalvarieties anddescriptionofsomeparticularclasses ofsphericalvarieties 6http://www mathnetorkr/new_sub04/sub04_01_01php?no=4275&ko_name=Boris+Pasquier&paper_id=&key_locale=out(Boris Pasquier) 2009-07-01 KIASSeminar -Introductiontosphericalvarieties anddescriptionofsomeparticularclasses ofsphericalvarieties 3http://www mathnetorkr/new_sub04/sub04_01_01php?no=4275&ko_name=Boris+Pasquier&paper_id=&key_locale=out(Boris Pasquier) 2009-06-30 KIASSeminar -Introductiontosphericalvarieties anddescriptionofsomeparticularclasses ofsphericalvarieties 4http://www mathnetorkr/new_sub04/sub04_01_01php?no=4275&ko_name=Boris+Pasquier&paper_id=&key_locale=out(Boris Pasquier) 2009-06-30 KIASSeminar -Introductiontosphericalvarieties anddescriptionofsomeparticularclasses ofsphericalvarieties 1http://www mathnetorkr/new_sub04/sub04_01_01php?no=4275&ko_name=Boris+Pasquier&paper_id=&key_locale=out(Boris Pasquier) 2009-06-29 KIASSeminar -Introductiontosphericalvarieties anddescriptionofsomeparticularclasses ofsphericalvarieties 2http://www mathnetorkr/new_sub04/sub04_01_01php?no=4275&ko_name=Boris+Pasquier&paper_id=&key_locale=out(Boris Pasquier) 2009-06-29 KIASSeminar -Lectures onabelianvarieties andintegrablesystems 7http://www mathnetorkr/new_sub04/sub04_01_01php?no=4279&ko_name=Samuel+Grushevsky&paper_id=&key_locale=out(SamGrushevsky) 2009-06-25 KIASSeminar -Lectures onabelianvarieties andintegrablesystems 8http://www mathnetorkr/new_sub04/sub04_01_01php?no=4279&ko_name=Samuel+Grushevsky&paper_id=&key_locale=out(SamGrushevsky) 2009-06-25 2009NIMSHotTopicWorkshoponInfiniteDimensionalAnalysis andRelatedTopics -Probabilities ofanalogueofWienerpaths crossindifferentiablecurves (KunSikRyu) 2009-06-24 2009NIMSHotTopicWorkshoponInfiniteDimensionalAnalysis andRelatedTopics -Someresults onintegraltransforms foraclass offunctionals definedonthespaceK [0 T](BongJinKim) 2009-06-24 2009NIMSHotTopicWorkshoponInfiniteDimensionalAnalysis andRelatedTopics -Feynmans OperationalCalculiandNoncommutativeAnalysis (ByoungSooKim) 2009-06-24 2009NIMSHotTopicWorkshoponInfiniteDimensionalAnalysis andRelatedTopics -Anaverageoverafunctionspaceandits applicationtoplanarshapes (JeongKyu Kim) 2009-06-24 KIASSeminar -Lectures onabelianvarieties andintegrablesystems 5http://www mathnetorkr/new_sub04/sub04_01_01php?no=4279&ko_name=Samuel+Grushevsky&paper_id=&key_locale=out(SamGrushevsky) 2009-06-24 KIASSeminar -Lectures onabelianvarieties andintegrablesystems 6http://www mathnetorkr/new_sub04/sub04_01_01php?no=4279&ko_name=Samuel+Grushevsky&paper_id=&key_locale=out(SamGrushevsky) 2009-06-24 2009NIMSHotTopicWorkshoponInfiniteDimensionalAnalysis andRelatedTopics -Transformations onGaussianFunctionals http://www mathnetorkr/new_sub04/sub04_01_01php?no=4437&ko_name=Un+Cig+Ji&paper_id=(UnCigJi) 2009-06-24 2009NIMSHotTopicWorkshoponInfiniteDimensionalAnalysis andRelatedTopics -Analogues ofconditionalWienerintegrals andtheirrelatedchangeofscaletransformations overgeneralizedWienerpaths (DongHyunCho) 2009-06-24 2009NIMSHotTopicWorkshoponInfiniteDimensionalAnalysis andRelatedTopics -RecentDevelopments inQuantumWhiteNoiseCalculus :QuantumWhiteNoiseDerivatives andImplementationProblemhttp://www mathnetorkr/new_sub04/sub04_01_01php? no=4438&ko_name=Nobuaki+Obata&paper_id=(NobuakiObata) 2009-06-23 KIASSeminar -Lectures onabelianvarieties andintegrablesystems 3http://www mathnetorkr/new_sub04/sub04_01_01php?no=4279&ko_name=Samuel+Grushevsky&paper_id=&key_locale=out(SamGrushevsky) 2009-06-23 KIASSeminar -Lectures onabelianvarieties andintegrablesystems 4http://www mathnetorkr/new_sub04/sub04_01_01php?no=4279&ko_name=Samuel+Grushevsky&paper_id=&key_locale=out(SamGrushevsky) 2009-06-23 2009NIMSHotTopicWorkshoponInfiniteDimensionalAnalysis andRelatedTopics -Integrationwithrespecttovectormeasures andtheLyapunovconvexitytheorem (ChangsunChoi) 2009-06-23 2009NIMSHotTopicWorkshoponInfiniteDimensionalAnalysis andRelatedTopics -InvarianceofPoissonmeasures underrandomtransformations http://www mathnetorkr/new_sub04/sub04_01_01php?no=4452&ko_name=Nicolas+Privault&paper_id=(Nicolas Privault) 2009-06-23 2009NIMSHotTopicWorkshoponInfiniteDimensionalAnalysis andRelatedTopics -MarkovChains GeneratedbyPositiveKernels andtheInverses ofPositiveOperators (HyunJaeYoo) 2009-06-22 2009NIMSHotTopicWorkshoponInfiniteDimensionalAnalysis andRelatedTopics -BasicFormulas forintegraltransfoms convolutionproducts andinverseintegraltransfforms offunctionals inL_2(C_0[0T])(HyunSooChung) 2009-06-22 2009NIMSHotTopicWorkshoponInfiniteDimensionalAnalysis andRelatedTopics -Onsquareroots ofHaarstates (UweFranz) 2009-06-22 KIASSeminar -Lectures onabelianvarieties andintegrablesystems 1http://www mathnetorkr/new_sub04/sub04_01_01php?no=4279&ko_name=Samuel+Grushevsky&paper_id=&key_locale=out(SamGrushevsky) 2009-06-22 KIASSeminar -Lectures onabelianvarieties andintegrablesystems 2http://www mathnetorkr/new_sub04/sub04_01_01php?no=4279&ko_name=Samuel+Grushevsky&paper_id=&key_locale=out(SamGrushevsky) 2009-06-22 ASARCSeminar -ConvexAlgebraicGeometryhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4246&ko_name=Bernd+Sturmfels&paper_id=&key_locale=out(BerndSturmfels) 2009-06-22 ASARCSeminar -AnInvitationtoAlgebraicStatistics http://www mathnetorkr/new_sub04/sub04_01_01php?no=4246&ko_name=Bernd+Sturmfels&paper_id=&key_locale=out(BerndSturmfels) 2009-06-22 TropicalGeometry -Lecture9:CountingCurves http://www mathnetorkr/new_sub04/sub04_01_01php?no=4246&ko_name=Bernd+Sturmfels&paper_id=&key_locale=out(BendStrumfels) 2009-06-19 ASARCSeminar -Linearindependenceofzeros ofL-functions (ByungchulCha) 2009-06-19 TropicalGeometry -Lecture10:TropicalDiscriminanthttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4246&ko_name=Bernd+Sturmfels&paper_id=&key_locale=out(BerndSturmfels) 2009-06-19 TropicalGeometry -Lecture7:Morphims andSecantVarieties http://www mathnetorkr/new_sub04/sub04_01_01php?no=4246&ko_name=Bernd+Sturmfels&paper_id=&key_locale=out(BendStrumfels) 2009-06-18 TropicalGeometry -Lecture8:Whatis therankofamatrix?http://www mathnetorkr/new_sub04/sub04_01_01php?no=4246&ko_name=Bernd+Sturmfels&paper_id=&key_locale=out(BendStrumfels) 2009-06-18 2009NIMSInternationalWorkshoponMathematicalCryptology -Theprovablesecurityofasymmetricprivacyandauthenticity:definitions designmethodologies prooftechniques andrelatedissues VI(PascalPaillier) 2009-06-18 -How Creepyis theSouthernSanAndreas Fault?(Prof YuriFialko) 2009-06-18 2009NIMSInternationalWorkshoponMathematicalCryptology -Theprovablesecurityofasymmetricprivacyandauthenticity:definitions designmethodologies prooftechniques andrelatedissues III(PascalPaillier) 2009-06-17 2009NIMSInternationalWorkshoponMathematicalCryptology -Optimizations forellipticcurveandpairing-basedcryptographywiththeapplicationtosignatures fornetworkingcodingII(KristinLauter) 2009-06-17 2009NIMSInternationalWorkshoponMathematicalCryptology -Economics ofprovablesecurityandprobablesecurityII(KantaMatsuura) 2009-06-17 2009NIMSInternationalWorkshoponMathematicalCryptology -Economics ofprovablesecurityandprobablesecurityI(KantaMatsuura) 2009-06-17 TropicalGeometry -Lecture6:Grassmannians (BendStrumfels) 2009-06-17 2009NIMSInternationalWorkshoponMathematicalCryptology -Theprovablesecurityofasymmetricprivacyandauthenticity:definitions designmethodologies prooftechniques andrelatedissues IV (PascalPaillier) 2009-06-17 TropicalGeometry -Lecture5:Matroids andLinearSpaces (BendStrumfels) 2009-06-17 2009NIMSInternationalWorkshoponMathematicalCryptology -Optimizations forellipticcurveandpairing-basedcryptographywiththeapplicationtosignatures fornetworkingcodingI(KristinLauter) 2009-06-16 2009NIMSInternationalWorkshoponMathematicalCryptology -SimulationofOracles (PascalPaillier) 2009-06-16 2009NIMSInternationalWorkshoponMathematicalCryptology -Thegapbetweentheoryandreality(SeungjooKim) 2009-06-16 2009NIMSInternationalWorkshoponMathematicalCryptology -SearchableSymmetricEncryption(Nam-SuJho) 2009-06-16 2009NIMSInternationalWorkshoponMathematicalCryptology -Theprovablesecurityofasymmetricprivacyandauthenticity:definitions designmethodologies prooftechniques andrelatedissues II(PascalPaillier) 2009-06-16 TropicalGeometry -Lecture4:TheFundamentalTheorem(BendStrumfels) 2009-06-16 2009NIMSInternationalWorkshoponMathematicalCryptology -Theprovablesecurityofasymmetricprivacyandauthenticity:definitions designmethodologies prooftechniques andrelatedissues I(PascalPaillier) 2009-06-16 TropicalGeometry -Lecture3:Fields andPolyhedra(BendStrumfels) 2009-06-16 TropicalGeometry -Lecture1:ElementaryIntroduction(BendStrumfels) 2009-06-15 2009CryptoSummer School (3)(Kwon Taekyoung) 2009-06-15 2009CryptoSummer School (2)http://www mathnetorkr/new_sub04/sub04_01_01php?no=1842&ko_name=%EC%B2%9C%EC%A0%95%ED%9D%AC&paper_id=&key_name=%EC%B2%9C%EC%A0%95%ED%9D%AC&key_locale=in(Cheon Junghee) 2009-06-15 2009CryptoSummer School (1)http://www mathnetorkr/new_sub04/sub04_01_01php?no=1842&ko_name=%EC%B2%9C%EC%A0%95%ED%9D%AC&paper_id=&key_name=%EC%B2%9C%EC%A0%95%ED%9D%AC&key_locale=in(Cheon Junghee) 2009-06-15 TropicalGeometry -Lecture2:Eigenvalues andEigenvectors (BendStrumfels) 2009-06-15 2009CryptoSummer School (2)(Kwon Taekyoung) 2009-06-14 2009CryptoSummer School (1)(Kwon Taekyoung) 2009-06-14 2009CryptoSummer School (2)(Hong SeokHie) 2009-06-14 2009CryptoSummer School -Pairing (1)(Lee Hyang-Sook) 2009-06-14 2009CryptoSummer School (1)(Hong SeokHie) 2009-06-14 2009CryptoSummer School -EllipticCurves (2)(Hahn SangGeun) 2009-06-14 2009CryptoSummer School -EllipticCurves (1)(Hahn SangGeun) 2009-06-13 2009CryptoSummer School (3)(Lee In-Sok) 2009-06-13 2009CryptoSummer School (2)(Lee In-Sok) 2009-06-13 2009CryptoSummer School (1)(Lee In-Sok) 2009-06-13 ASARCSeminar -Knottingsurfaces in4-manifolds bytwist-rimsurgery(HeeJungKim) 2009-06-12 -RemotesensingofcoastalenvironmentusingSyntheticApertureRadar( ) 2009-06-12 2009ASARCWORKSHOP -IntroductiontoGKM theory1(ShintaroKuroki) 2009-06-06 2009ASARCWORKSHOP -Seshadrinumberalongasubvarietyhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=2086&ko_name=%ED%99%A9%EC%A4%80%EB%AC%B5&paper_id=&key_name=%ED%99%A9%EC%A4%80%EB%AC%B5&key_locale=in(Jun-Muk Hwang) 2009-06-06 2009ASARCWORKSHOP -IntroductiontoGKM theory2(ShintaroKuroki) 2009-06-06 2009ASARCWORKSHOP -Calibernumberofrealquadraticfields (Lee Jungyun) 2009-06-05 2009ASARCWORKSHOP -EvaluationoftheDedekindzetafunctions ats =-1ofthesimplestquarticfields (JunHoLee) 2009-06-05 2009ASARCWORKSHOP http://www mathnetorkr/new_sub04/sub04_01_01php?no=1842&ko_name=%EC%B2%9C%EC%A0%95%ED%9D%AC&paper_id=&key_name=%EC%B2%9C%EC%A0%95%ED%9D%AC&key_locale=in(Cheon Junghee) 2009-06-05 2009ASARCWORKSHOP -MotivizationforadditiveK-theory(JinhyunPark) 2009-06-05 2009ASARCWORKSHOP -Traces ofclass invariants (Soon-YiKang) 2009-06-05 -Regionaltolocal-scaleapplicationusingsatelliteandnear-surfacegeopotentialdata:Antarcticcase( ) 2009-06-05 -EvaluationofCO Storagemechanisms atSACROC siteof35years ofCO injection( ) 2009-06-05 2009ASARCWORKSHOP -Gradedmappingconetheorem Mutisecants andequations http://www mathnetorkr/new_sub04/sub04_01_01php? no=2206&ko_name=%EA%B3%BD%EC%8B%9C%EC%A2%85&paper_id=&key_name=%EA%B3%BD%EC%8B%9C%EC%A2%85&key_locale=in(Kwak Sijong) 2009-06-04 2009ASARCWORKSHOP -Surveyonvertex-minors andpivot-minors (Oum Sang-il) 2009-06-04 2009ASARCWORKSHOP -NormalBases ofTheRayClass Fields OverImaginaryQuadraticFields (Jung HoYun) 2009-06-04 KSIAM2009SpringConference -Ontheclassicalsolutionto3-dimensionalquasi-geostrophicequations withpotentialvorticity(Lee Jihoon) 2009-05-30 KSIAM2009SpringConference -UniquestabilityforthestationaryNavier-Stokes equations inexteriordomains (Kim Hyunseok) 2009-05-30 KSIAM2009SpringConference -AprioricriterionforinviscidlimitofNavier-Stokes equations (Kim Namkwon) 2009-05-30 KSIAM2009SpringConference -High-orderAccurateSolutions UsinganImplicitDiscomtinuous GalerkinMethodonUnstructuredMeshes (Lee HeeDong) 2009-05-29 KSIAM2009SpringConference -IntroductiontoGyrokineticParticleInCellTechniqueforFusionPlasmaTurbulenceSimulationandDevelopmentofSemi-LagrangianMethod(Kwon Jae-Min) 2009-05-29 KSIAM2009SpringConference -FluidSimulations onDivertorPlasmas inKSTARTokamak(Kim SungSik) 2009-05-29 KSIAM2009SpringConference -IntroductiontoNonlinearMagnetohydrodynamicInstabilitySimulationinTokamakPlasmas (Kim Jayhyun) 2009-05-29 KSIAM2009SpringConference -Status ofMulti-scalesimulationonFusionMaterials (Choi JungHae) 2009-05-29 KSIAM2009SpringConference -ThenumericalsolutionfortheVlasovequationusingWENO methods (Ha Youngsoo) 2009-05-29 KSIAM2009SpringConference -A LEVEL-SETMETHOD FORCOMPUTATION OF DROPLETMOTION IN AN INKJETPRINTING PROCESS (Son Gihun) 2009-05-29 KSIAM2009SpringConference -Anadaptivelevelsetmethodonquadtreegrids (Min Chohong) 2009-05-29 KSIAM2009SpringConference -DenoisingofBzDataforConductivityReconstructioninMagneticResonanceElectricalImpedanceTomography(MREIT)(Lee Chang-Ock) 2009-05-29 KSIAM2009SpringConference -CurveEvolutions byaDualShapeConstraint(Hong Byung-woo) 2009-05-29 KSIAM2009SpringConference -New Algorithms inInformationSciencehttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4469&ko_name=Stanley+Osher&paper_id=(StanleyOsher) 2009-05-29 2009 -AnIntroductiontoGEOTRACES (RobertF Anderson) 2009-05-28 2009 -LatitudinaldistributionofmesozooplanktonitheoffequatorialnortheasternPacificbeforeandafterthe1998/99LaNinaevent(Jung-HoonKang) 2009-05-28 2009 -2007 2008 ( ) 2009-05-28 2009 ENSO-PDO ( ) 2009-05-28 2009 -Analysis oftheNorthPacificSSTVariation( ) 2009-05-28 2009 -MODIS ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 -3 ( ) 2009-05-28 2009 -Current-InducedWae-likeMotioninShallow Water(GuanHongLEE) 2009-05-28 2009 ( ) 2009-05-28 2009 (GDPS) ( ) 2009-05-28 2009 (GOCI) ( ) 2009-05-28 2009 -Accuracyanalyssis ofthesurfacevelocityderivedbyHF-RadaralongtheeastcoastofKorea( ) 2009-05-28 2009 -Offshoredetachmentprocess ofthelow-salinitywateraroundChangjinagBankintheEastChinaSea( ) 2009-05-28 2009 / ( ) 2009-05-28 2009 -Verticalmixingeffects onchlorophyll-aconcentrationinthenorthernEastChinaSeaduringsummer( ) 2009-05-28 2009 -Long-termchangeoflatentandsensibleheatfluxes intehKoreaWaters ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 -Observationofwarmingofdeepwaterandslowdownofits movementinthesouthwesternEastSea( ) 2009-05-28 2009 -SeasonalVariationoftheUpperLayerCirculationintehNorthernPartoftheEast/JapanSea(TaeKyunKim) 2009-05-28 2009 ( ) 2009-05-28 2009 Acartiaomorii ( ) 2009-05-28 2009 -Matingsuccess andits consequences forpopulationgrowthinanestuarinecopepod( ) 2009-05-28 2009 ( ) ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 -Climate-drivenecosystemshifts indicatedinfisherycatchstatistics (1968-2008)formKoreancoastalwaters ( ) 2009-05-28 2009 -Regionalbackgroundconcentrations ofheavymetals inSouthSeasediments ( ) 2009-05-28 2009 -Enrichmentofsedimentheavymetals oversize-correctedbackgroundconcentrations incoastalareas oftheSouthSea( ) 2009-05-28 2009 : MREE( ) 2009-05-28 2009 -Biogeochemistryattheinterfaceofgroundandseawaterintheintertidalzone(WaskaHannelore) 2009-05-28 2009 : ( ) 2009-05-28 2009 -Wastewatertreatmentplants (WWTPs)as asourceofsedimentcontaminationbytoxicorganicpollutants andfecalsterols inasemi-enclosedbayinKorea( ) 2009-05-28 2009 ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 -CO emissionfromtheocean:Anestimationfromabasin-wideobserationintheAtlantic( ) 2009-05-28 2009 PM 25 ( ) 2009-05-28 2009 : ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 -ExternalcontrolonthearchitectureofinclinedheterolithicstratificationofmacrotidalSukmoChannel:waveversus rainfall( ) 2009-05-28 2009 MixingDepth( ) 2009-05-28 2009 -Sedimentdynamics relatedtotheformationandmaintenanceofasandbankinGarolimBay westcoastofKorea( ) 2009-05-28 2009 ; ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 -Cobalt-richManganess Crust ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 -Linkages betweenmarineproductivityandcontinentalaridityfluctuations overthetropicalAtlanticAfricanregionsincethelastglacialmaximum(So-YoungKim) 2009-05-28 2009 (GOCI) ( ) 2009-05-28 2009 -Theimportanceofbenthicproductiontomacrozoobenthos:comparisonofNakdongandSeomjinRiverestuaries ( ) 2009-05-28 2009 -2012 Big-O ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 -Cochodfiniumpolykrikoides ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 -PetroleumHydrocarbonContaminationaftertheHebeiSpiritOilSpill( ) 2009-05-28 2009 ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 PAHs ( ) 2009-05-28 2009 PAHs ( ) 2009-05-28 2009 -SPATIALAND TEMPORALVARIATIONS OF RED TIDEIN THESOUTH SEA OF KOREA (WidhiyanuriyawanD) 2009-05-28 2009 ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 ( ) 2009-05-28 2009 : ( ) 2009-05-28 2009 ( ) 2009-05-22 2009 -LED ( ) 2009-05-22 2009 -LED Heatsink ( ) 2009-05-22 2009 -LED Heatsink ( ) 2009-05-22 2009 ( ) 2009-05-22 2009 ?( ) 2009-05-22 2009 -AcousticcharacteristicofthelargejellyfishNemopilemanomarai(MiyukiHirose) 2009-05-22 2009 ( ) 2009-05-22 2009 ( ) 2009-05-22 2009 ( ) 2009-05-22 TEM ( ) 2009-05-22 2009Springcolloquium -Well-quasi-orderingtournaments andRaos degree-sequenceconjecturehttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4453&ko_name=Paul+Seymour&paper_id=(PaulSeymour) 2009-05-21 ASARCSeminar -Packingseagulls ingraphs withnostablesetofsizethreehttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4454&ko_name=Maria+Chudnovsky&paper_id=(MariaChudnovsky) 2009-05-21 Facetheworldwithmathematicalmind -TheTownThatNeverExisted(JohnPark) 2009-05-15 -SynchrotroninfraredandX-raydiffractionstudies onhydrous minerals underextremeconditions (ZhenxianLiu) 2009-05-15 -Spectroscopicinvestigationofmineralsurfaces forthereductionofenvironmentalcontaminants ( ) 2009-05-08 ASARCIntensiveLecture -IntroductiontoSchubertCalculus 4(MasakiNakagawa) 2009-05-06 ASARCIntensiveLecture -IntroductiontoSchubertCalculus 3(MasakiNakagawa) 2009-05-06 ASARCIntensiveLecture -IntroductiontoSchubertCalculus 2(MasakiNakagawa) 2009-05-04 ASARCIntensiveLecture -IntroductiontoSchubertCalculus 1(MasakiNakagawa) 2009-05-04 -Monitoring&CharacterizingNaturalHazards withSatelliteInterferometricRadar(ZhongLu) 2009-05-04 2009 ( ) 2009-05-02 -Ontheroleofcolloids forchemicalequilibriuminAquaticmedia( ) 2009-05-01 2009Springcolloquium -MathematicalChallenges inSystems Biology:NetworkMotifs andDynamics (Kwang-HyunCho) 2009-04-30 Workshopongeometricstructures andequivalenceproblems -Conformalstructureonafinitegraphhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4455&ko_name=Paul+Baird&paper_id=(PaulBAIRD) 2009-04-30 Workshopongeometricstructures andequivalenceproblems -Domains withhyperbolicorbitaccumulationpoints (SungYeonKIM) 2009-04-30 Workshopongeometricstructures andequivalenceproblems -Existenceoforthogonalcoordinates (ColleenROBLES) 2009-04-30 Workshopongeometricstructures andequivalenceproblems -TheMethodofDarboux--A HistoricalSurveyhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4736&ko_name=Ian+M +Anderson&paper_id=(IanM Anderson) 2009-04-30 Workshopongeometricstructures andequivalenceproblems -Iso-trivialconestructures withcharacteristicconnections http://www mathnetorkr/new_sub04/sub04_01_01php? no=2086&ko_name=%ED%99%A9%EC%A4%80%EB%AC%B5&paper_id=&key_name=%ED%99%A9%EC%A4%80%EB%AC%B5&key_locale=in(Jun-MukHWANG) 2009-04-29 Workshopongeometricstructures andequivalenceproblems -Geodesicallyequivalentmetrics http://www mathnetorkr/new_sub04/sub04_01_01php?no=4737&ko_name=Vladimir+S +Matveev&paper_id=(VladimirS Matveev) 2009-04-29 Workshopongeometricstructures andequivalenceproblems -CharacterizationofasmoothSchubertvariety(JaehyunHONG) 2009-04-28 Workshopongeometricstructures andequivalenceproblems -Holonomyofpseudo-Riemanniancones andKillingspinors http://www mathnetorkr/new_sub04/sub04_01_01php?no=4457&ko_name=Vicente+Cortes&paper_id=(VicenteCortes) 2009-04-28 Workshopongeometricstructures andequivalenceproblems -Analyticcontinuationofgerms ofholomorphicmaps respectingvarieties ofminimalrationaltangents http://www mathnetorkr/new_sub04/sub04_01_01php?no=4456&ko_name=Ngaiming+Mok&paper_id=(NgaimingMOK) 2009-04-28 Workshopongeometricstructures andequivalenceproblems -Thegeometryof3-dimensionalvectordistributions http://www mathnetorkr/new_sub04/sub04_01_01php?no=4738&ko_name=Boris+Doubrov&paper_id=(Boris Doubrov) 2009-04-28 Workshopongeometricstructures andequivalenceproblems -Differentialequations associatedwitharepresentationofaLiealgebraandextrinsicgeometryofsubmanifolds inaflagmanifold(TohruMORIMOTO) 2009-04-28 Workshopongeometricstructures andequivalenceproblems -Notes oncontactRiccisolitons (JongTaekCHO) 2009-04-27 Workshopongeometricstructures andequivalenceproblems -Para-CRstructures anddifferentialequations http://www mathnetorkr/new_sub04/sub04_01_01php?no=4660&ko_name=Pawel+Nurowski&paper_id=(PawelNurowski) 2009-04-27 Workshopongeometricstructures andequivalenceproblems -How torecognisethegeodesics ofametricconnectionhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4458&ko_name=Michael+Eastwood&paper_id=(MichaelEASTWOOD) 2009-04-27 Workshopongeometricstructures andequivalenceproblems -Generalizations oftheFrobenius theoremforPfaffiansystems andthesolvabilityquestions (Chong-KyuHAN) 2009-04-27 Workshopongeometricstructures andequivalenceproblems -Feffermanlikeconstructions forparabolicgeometries http://www mathnetorkr/new_sub04/sub04_01_01php?no=4460&ko_name=Jan+Slovak&paper_id=(JanSLOVAK) 2009-04-27 ASARCSeminar -Hassett-TschinkelCorrespondenceandAutomorphismoftheQuadric(ElenaSharoyko) 2009-04-24 2009Springcolloquium -StructuredPopulationModels andtheirComputationalMethods (KimMi-Young) 2009-04-23 2009Springcolloquium -EquilibriumEquityPremium InterestRateandtheCostofCapitalinaSingle-FirmEconomyunderMoralHazard(SeongJaeYoung) 2009-04-16 KAIST DiscreteMathSeminar -MarkovChainMonteCarloandApproximatingthePermanenthttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4470&ko_name=Eric+Vigoda&paper_id=(EricVigoda) 2009-04-13 2009AlgebraicGeometryWorkshopatKAIST -Normality equations andsyzygies ofsecantvarieties II(PeterVermeire) 2009-04-11 2009AlgebraicGeometryWorkshopatKAIST -generalizationofCastelnuovo-Mumfordregularityforrepresentations (HyungjuPark) 2009-04-11 2009AlgebraicGeometryWorkshopatKAIST -Projectivevarieties withnonbirationallinearprojections andapplications http://www mathnetorkr/new_sub04/sub04_01_01php?no=4384&ko_name=Atsushi+Noma&paper_id=(AtsushiNoma) 2009-04-10 2009AlgebraicGeometryWorkshopatKAIST -Geometryofmodulispaces ofstablesheaves onsurfaces andembeddedcurves (SukmoonHuh) 2009-04-10 2009AlgebraicGeometryWorkshopatKAIST -Regularityofprojectivevarieties andclassicalCastelnuovos methods http://www mathnetorkr/new_sub04/sub04_01_01php?no=4739&ko_name=Chikashi+Miyazaki&paper_id=(ChikashiMiyazaki) 2009-04-10 2009AlgebraicGeometryWorkshopatKAIST -Cliffordindices forvectorbundles oncurves IIhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4467&ko_name=Herbert+Lange&paper_id=(HerbertLange) 2009-04-10 2009AlgebraicGeometryWorkshopatKAIST -Normality equations andsyzygies ofsecantvarieties I(PeterVermeire) 2009-04-10 : ( ) 2009-04-10 2009AlgebraicGeometryWorkshopatKAIST -Characteristicfoliationofahypersurfaceofgeneraltypeonaprojectivesymplecticmanifoldhttp://www mathnetorkr/new_sub04/sub04_01_01php? no=2086&ko_name=%ED%99%A9%EC%A4%80%EB%AC%B5&paper_id=&key_name=%ED%99%A9%EC%A4%80%EB%AC%B5&key_locale=in(Hwang Junmuk) 2009-04-09 2009AlgebraicGeometryWorkshopatKAIST -TheIitakaconjectureindimension6(CaucherBirkar) 2009-04-09 2009AlgebraicGeometryWorkshopatKAIST -Segreinvariants ofvectorbundles oncurves andhighersecantvarieties (InsongChoe) 2009-04-09 2009AlgebraicGeometryWorkshopatKAIST -Cliffordindices forvectorbundles oncurves http://www mathnetorkr/new_sub04/sub04_01_01php?no=4467&ko_name=Herbert+Lange&paper_id=(HerbertLange) 2009-04-09 ASARCSeminar -Brill-Noethertheoryofvectorbundles onCurves IIIhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4467&ko_name=Herbert+Lange&paper_id=(HerbertLange) 2009-04-08 ASARCSeminar -Equations Syzygies ofProjectiveVarieties andVarieties ofSecantLines (PeterVermeire) 2009-04-08 KIASSeminar -Sheaves ontoricCalabi-Yauhypersurfaces (VladimirBaranovsky) 2009-04-07 KIASSeminar -WeakLandau-Ginzburgmodels andrationalityproblems (VictorPrzyjalkowski) 2009-04-07 KAIST DiscreteMathSeminar -Sometopics inspectralgraphtheory(JackKoolen) 2009-03-27 ( ) 2009-03-27 - ( ) 2009-03-20 2009Springcolloquium -A mathematicalmodelforunsteadycontactmelting(TimMyers) 2009-03-19 KIASSeminar -Lectures onToricDegenerations PotentialFunctions andGelfand-CetlinSystems (TakeoNishinou) 2009-03-17 KIASSeminar -Lectures onToricDegenerations PotentialFunctions andGelfand-CetlinSystems (YuichiNohara) 2009-03-17 KAIST DiscreteMathSeminar -Aneffectivewebcrawlingorderingfromgraphsearchtechniques (Park KeunSoo) 2009-03-16 Facetheworldwithmathematicalmind -TheMusicinLogic(RyuJaeJoon) 2009-03-13 ASARCIntensiveLectures -Discussingstructureandapplications ofspectralsequences http://www mathnetorkr/new_sub04/sub04_01_01php?no=4468&ko_name=John+McCleary&paper_id=(JohnMcCleary) 2009-03-13 2009Springcolloquium -A HistoryofAlgebraicTopologyhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4468&ko_name=John+McCleary&paper_id=(JohnMcCleary) 2009-03-12 ASARCIntensiveLectures -Discussingstructureandapplications ofspectralsequences http://www mathnetorkr/new_sub04/sub04_01_01php?no=4468&ko_name=John+McCleary&paper_id=(JohnMcCleary) 2009-03-11 ASARCSeminar -Projectivenormalityofabelianvarieties http://www mathnetorkr/new_sub04/sub04_01_01php?no=4741&ko_name=Jaya+Nn+Iyer&paper_id=(JayaIyer) 2009-03-04 ASARCSeminar -Introductorylectures onmultiplierideals IV (Hwang Jun-Muk) 2009-03-04 ASARCSeminar -Introductorylectures onmultiplierideals II(Hwang Jun-Muk) 2009-03-04 ASARCSeminar -Introductorylectures onmultiplierideals III(Hwang Jun-Muk) 2009-03-04 ASARCSeminar -Introductorylectures onmultiplierideals I(Hwang Jun-Muk) 2009-03-04 2009Springcolloquium -Actions offinitegroups onpowerseries rings http://www mathnetorkr/new_sub04/sub04_01_01php?no=2546&ko_name=Ted+Chinburg&paper_id=Ted(TedChinburg) 2009-03-03 KAIST DiscreteMathSeminar -Injectivecolorings ofgraph(Kim Seog-Jin) 2009-02-27 ASARCSeminar -Theplus/minus Iwasawatheoryfortheabelianvarieties associatedtomodularforms (Kim ByungDoo) 2009-02-23 2009Springcolloquium -OptimalQueryComplexityBounds forFindingGraphs (Kim JeongHan) 2009-02-19 2009ConferenceoftheKoreanTEXSociety(TEX:Past Present andFuture) -MeetingoftheTEX andScriptLanguages (Lee KiHwang) 2009-02-14 2009ConferenceoftheKoreanTEXSociety(TEX:Past Present andFuture) ( ) 2009-02-14 2009ConferenceoftheKoreanTEXSociety(TEX:Past Present andFuture) ( ) 2009-02-14 2009ConferenceoftheKoreanTEXSociety(TEX:Past Present andFuture) ( ) 2009-02-14 2009ConferenceoftheKoreanTEXSociety(TEX:Past Present andFuture) -EducationintheuseofTEX (Kim YoungRok) 2009-02-14 2009ConferenceoftheKoreanTEXSociety(TEX:Past Present andFuture) -PublishedinthefielduseofTEX (Lee JooHo) 2009-02-14 2009ConferenceoftheKoreanTEXSociety(TEX:Past Present andFuture) -IntroductiontoLuaTeX andConTeXt2(Hans Hagen) 2009-02-14 2009ConferenceoftheKoreanTEXSociety(TEX:Past Present andFuture) -IntroductiontoLuaTeX andConTeXt1(TacoHoekwater) 2009-02-14 2009ConferenceoftheKoreanTEXSociety(TEX:Past Present andFuture) -TEX:Past Present andFuture(Kim KangSoo) 2009-02-14 DepartmentofMathematicalSciences Seminar KAIST -StructuredProducts http://www mathnetorkr/new_sub04/sub04_01_01php?no=4743&ko_name=Harry+Zheng&paper_id=(HarryZheng) 2009-02-13 DepartmentofMathematicalSciences Seminar KAIST -PortfolioCreditRiskhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4743&ko_name=Harry+Zheng&paper_id=(HarryZheng) 2009-02-11 DepartmentofMathematicalSciences Seminar KAIST -A glimpseofcombinatorialgeometry(Andreas Holmsen) 2009-02-05 KAIST COMBINATORICSSEMINAR -Growthfunctionofaclass ofmonoids http://www mathnetorkr/new_sub04/sub04_01_01php?no=4744&ko_name=Philippe+Nadeau&paper_id=(PhilippeNadeau) 2009-02-05 KAIST COMBINATORICSSEMINAR -Maximumnumberofcompletesubgraphs inacertaingraph( ) 2009-02-04 KAIST COMBINATORICSSEMINAR -Thestructureofalternativetableauxhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4744&ko_name=Philippe+Nadeau&paper_id=(PhilippeNadeau) 2009-02-04 KAIST COMBINATORICSSEMINAR -TBA http://www mathnetorkr/new_sub04/sub04_01_01php?no=4471&ko_name=%EC%B5%9C%EC%88%98%EC%98%81&paper_id=&key_name=%EC%B5%9C%EC%88%98%EC%98%81&key_locale=in(Choi Suyoung) 2009-02-04 KAIST COMBINATORICSSEMINAR -Welllabeledpaths andthevolumeofapolytopehttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4744&ko_name=Philippe+Nadeau&paper_id=(PhilippeNadeau) 2009-02-04 NIMSWorkshopandMinicourse:MathematicalAnalysis Numerics andApplicationinfluidandgas dynamics -Dynamicbifurcationoftheone-dimensionalSwift-Hohenbergequation(JongminHan) 2009-02-03 NIMSWorkshopandMinicourse:MathematicalAnalysis Numerics andApplicationinfluidandgas dynamics -Effectiveconductivityinmulti-scalemedia(BongsooJang) 2009-02-03 NIMSWorkshopandMinicourse:MathematicalAnalysis Numerics andApplicationinfluidandgas dynamics -Temporaldecays in$L^1$and$L\infty$fortheStokes flow ( ) 2009-02-03 NIMSWorkshopandMinicourse:MathematicalAnalysis Numerics andApplicationinfluidandgas dynamics -TBA (Sun-ChulKim) 2009-02-03 NIMSWorkshopandMinicourse:MathematicalAnalysis Numerics andApplicationinfluidandgas dynamics -A FETI-DP formulationfortheStokes problemwithoutprimalpressureunknowns (HyeaHyunKim) 2009-02-03 NIMSWorkshopandMinicourse:MathematicalAnalysis Numerics andApplicationinfluidandgas dynamics -Decayrateofstrongsolutions ofthe3D NSEwithnonzerofarfieldvelocity(JaiokRoh) 2009-02-03 NIMSWorkshopandMinicourse:MathematicalAnalysis Numerics andApplicationinfluidandgas dynamics -Optimalcontrolproblems forthetwodimensionalRayleih-Benardconvection(Hyung-ChunLee) 2009-02-02 NIMSWorkshopandMinicourse:MathematicalAnalysis Numerics andApplicationinfluidandgas dynamics -TBA (Eun-JaePark) 2009-02-02 NIMSWorkshopandMinicourse:MathematicalAnalysis Numerics andApplicationinfluidandgas dynamics -Mathematics offlockingII( ) 2009-01-31 NIMSWorkshopandMinicourse:MathematicalAnalysis Numerics andApplicationinfluidandgas dynamics -Structureofsolutions toconservationlaws IIhttp://www mathnetorkr/new_sub04/sub04_01_01php? no=4112&ko_name=%EA%B9%80%EC%9A%A9%EC%A0%95&paper_id=&key_name=%EA%B9%80%EC%9A%A9%EC%A0%95&key_locale=in(Kim Yongjung) 2009-01-31 NIMSWorkshopandMinicourse:MathematicalAnalysis Numerics andApplicationinfluidandgas dynamics -MathematicaltheoryofNon-NewtonianfluidII( ) 2009-01-30 NIMSWorkshopandMinicourse:MathematicalAnalysis Numerics andApplicationinfluidandgas dynamics -Structureofsolutions toconservationlaws Ihttp://www mathnetorkr/new_sub04/sub04_01_01php? no=4112&ko_name=%EA%B9%80%EC%9A%A9%EC%A0%95&paper_id=&key_name=%EA%B9%80%EC%9A%A9%EC%A0%95&key_locale=in(Kim Yongjung) 2009-01-30 NIMSWorkshopandMinicourse:MathematicalAnalysis Numerics andApplicationinfluidandgas dynamics -Mathematics offlockingI( ) 2009-01-30 NIMSWorkshopandMinicourse:MathematicalAnalysis Numerics andApplicationinfluidandgas dynamics -Basicnumercicalmethods forimageprocessingII( ) 2009-01-30 NIMSWorkshopandMinicourse:MathematicalAnalysis Numerics andApplicationinfluidandgas dynamics -Basicnumercicalmethods forimageprocessingI( ) 2009-01-29 NIMSWorkshopandMinicourse:MathematicalAnalysis Numerics andApplicationinfluidandgas dynamics -MathematicaltheoryofNon-NewtonianfluidI( ) 2009-01-29 ASARCIntensiveLectures -p-adicfunctions p-adicrepresentations and(\varphi \Gamma)-modules http://www mathnetorkr/new_sub04/sub04_01_01php?no=4747&ko_name=Yi+Ouyang&paper_id=(YiOuyang) 2009-01-12 ASARCIntensiveLectures -p-adicfunctions p-adicrepresentations and(\varphi \Gamma)-modules http://www mathnetorkr/new_sub04/sub04_01_01php?no=4747&ko_name=Yi+Ouyang&paper_id=(YiOuyang) 2009-01-12 DepartmentofMathematicalSciences Seminar KAIST -p-adicregulatoronindecomposableK_1ofellipticsurface(partI partI)http://www mathnetorkr/new_sub04/sub04_01_01php?no=4745&ko_name=Masanori+Asakura&paper_id=(MasanoriAsakura) 2009-01-12 KAIST DiscreteMathSeminar -A Divisors ongraphs http://www mathnetorkr/new_sub04/sub04_01_01php?no=4746&ko_name=Serguei+Norin&paper_id=(SergueiNorin) 2009-01-07 Backtotopofpage 2008 KAIST DiscreteMathSeminar -A combinatorialapproachtothepowerof2inthenumberofinvolutions (Kim Jangsoo) 2008-12-11 2008FallColloquium DepartmentofMathematicalSciences KAIST -Enumerativegeometryandmodulispaces http://www mathnetorkr/new_sub04/sub04_01_01php? no=4231&ko_name=%EA%B9%80%EC%98%81%ED%9B%88&paper_id=&key_name=%EA%B9%80%EC%98%81%ED%9B%88&key_locale=in(Kiem Younghoon) 2008-12-05 : ( ) 2008-12-05 KAIST DiscreteMathSeminar -Turantypeproblems forbiddingcompletegraphs andcompletemultipartitegraphs togetherhttp://www mathnetorkr/new_sub04/sub04_01_01php? no=3938&ko_name=%EB%85%B8%EC%9C%A0%EB%AF%B8&paper_id=&key_name=%EB%85%B8%EC%9C%A0%EB%AF%B8&key_locale=in(Rho Yoomi) 2008-11-28 ( ) 2008-11-28 2008FallColloquium DepartmentofMathematicalSciences KAIST -Non-uniformfastFouriertransformation(NUFFT)andmagneticresonanceimaginghttp://www mathnetorkr/new_sub04/sub04_01_01php? no=1429&ko_name=%EC%9D%B4%EC%A4%80%EC%97%BD&paper_id=&key_name=%EC%9D%B4%EC%A4%80%EC%97%BD&key_locale=in(Lee Juneyub) 2008-11-27 2008 ( ) 2008-11-20 2008 (I)( ) 2008-11-20 2008 ( ) 2008-11-20 2008 ( ) 2008-11-20 2008 -NOWPAP (HNS) ( ) 2008-11-20 2008 ( ) 2008-11-20 2008 Slow down ( ) 2008-11-20 2008 ( ) 2008-11-20 2008 ( ) 2008-11-20 2008 ( ) 2008-11-20 2008 IMO ( ) 2008-11-20 2008 -MOERI ( ) 2008-11-20 2008 FaultTolerant ( ) 2008-11-20 2008 ( ) 2008-11-20 2008 ( ) 2008-11-20 2008 ( ) 2008-11-20 2008 ( ) 2008-11-20 2008 ( ) 2008-11-20 2008 ( ) 2008-11-20 2008 PAHs ( ) 2008-11-20 2008 ( ) 2008-11-20 2008 ( ) 2008-11-20 2008 ( ) 2008-11-20 2008 ( ) 2008-11-20 2008 ( ) 2008-11-20 2008 3D ( ) 2008-11-20 2008 -3 ( ) 2008-11-20 2008 -3 ( ) 2008-11-20 2008 -3 ( ) 2008-11-20 2008 ( ) 2008-11-20 2008 ( ) 2008-11-20 2008 -ModelingofNitrogenTransformationinArtificialWetland( ) 2008-11-20 2008 ( ) 2008-11-20 2008 -Energymodelingforsustainableuseoffisheries andaquacultureproductionatSongkhlalake Thailand(KankamnerdJariya) 2008-11-20 2008 ( ) 2008-11-20 AlgebraicGeometryinEastAsia -Everywhereintegralsections ofanelipticsurfacehttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4478&ko_name=Tetsuji+Shioda&paper_id=(TetsujiShioda) 2008-11-15 AlgebraicGeometryinEastAsia -McKaycorrespondenceforFuchsiangroups ofgenus 0http://www mathnetorkr/new_sub04/sub04_01_01php?no=4473&ko_name=Igor+V +Dolgachev&paper_id=(IgorDolgachev) 2008-11-15 AlgebraicGeometryinEastAsia -TBA http://www mathnetorkr/new_sub04/sub04_01_01php?no=4474&ko_name=David+Eisenbud&paper_id=(DavidEisenbud) 2008-11-14 AlgebraicGeometryinEastAsia -Onprojectivevarieties ofalmsotminimaldegreehttp://www mathnetorkr/new_sub04/sub04_01_01php? no=3952&ko_name=%EB%B0%95%EC%9D%98%EC%84%B1&paper_id=&key_name=%EB%B0%95%EC%9D%98%EC%84%B1&key_locale=in(Park Euisung) 2008-11-14 AlgebraicGeometryinEastAsia -Anotherformofthereciprocitylaw ofDedekindsumhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4699&ko_name=Mizuho+Ishizaka&paper_id=(MizuhoIshizaka) 2008-11-14 AlgebraicGeometryinEastAsia -Thefundamentalgroupschemeandapplications (PhungHoHai) 2008-11-14 AlgebraicGeometryinEastAsia -Bettinumbers ofGradedModuls andCohomologytables ofCoherentSheaves http://www mathnetorkr/new_sub04/sub04_01_01php?no=4480&ko_name=Frank-Olaf+Schreyer&paper_id=(Frank-OlafSchreyer) 2008-11-14 KAIST DiscreteMathSeminar -Approximabilityofabatchconsolidationproblem(Hong Sungpil) 2008-11-14 KAIST WorkshoponSyzygies andGeometry -Somequestions ongeneralprojections http://www mathnetorkr/new_sub04/sub04_01_01php?no=4474&ko_name=David+Eisenbud&paper_id=(DavidEisenbud) 2008-11-13 KAIST WorkshoponSyzygies andGeometry -Gradedmappingconeconstructions multisecants andregularityconjecturehttp://www mathnetorkr/new_sub04/sub04_01_01php? no=2206&ko_name=%EA%B3%BD%EC%8B%9C%EC%A2%85&paper_id=&key_name=%EA%B3%BD%EC%8B%9C%EC%A2%85&key_locale=in(Kwak Sijong) 2008-11-13 KAIST WorkshoponSyzygies andGeometry -Hilbertcoefficients andpowers ofidelas (JuergenHerzog) 2008-11-13 KAIST WorkshoponSyzygies andGeometry -Genericprojections ofsmoothvarieties andthecomplexityoftheirfibers (RoyaBeheshti) 2008-11-13 AlgebraicGeometryinEastAsia -Hilbertschemeoftwistedcubics viastablemaps http://www mathnetorkr/new_sub04/sub04_01_01php? no=4231&ko_name=%EA%B9%80%EC%98%81%ED%9B%88&paper_id=&key_name=%EA%B9%80%EC%98%81%ED%9B%88&key_locale=in(Kiem Younghoon) 2008-11-13 AlgebraicGeometryinEastAsia -GeneralizedZariski-vanKampentheoremhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4479&ko_name=Ichiro+Shimada&paper_id=(IchiroShimada) 2008-11-13 AlgebraicGeometryinEastAsia -OnFanovarietywithlargepseudo-indexhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4702&ko_name=Jiun-Cheng+Chen&paper_id=(Jiun-ChengChen) 2008-11-13 AlgebraicGeometryinEastAsia -Towarddeformations ofLagrangianfibrations onsymplecticvarieties http://www mathnetorkr/new_sub04/sub04_01_01php?no=4703&ko_name=Daisuke+Matsushita&paper_id=(DaisukeMatsushita) 2008-11-13 2008 -MCL3 aC-typelectionofManilaclam induceduponinfectionwithPerkinsus olseni(MausumiAdhya) 2008-11-13 2008 -Hemocytes fromthecarpetshellclamRuditapes decussatus andthemanilaclamRuditapes philippinarum:StateoftheArt(LudovicDonaghy) 2008-11-13 2008 Scapharcasubcrenata ( ) 2008-11-13 2008 -TBTCI Gomphinaveneriformis intersex( ) 2008-11-13 2008 Saxidomus purpuratus ( ) 2008-11-13 2008 - Octopus minor ( ) 2008-11-13 2008 -Histologyandultrastructureoffootepitheliallayeroftheequilateralvenus Gomphinaveneriformis (Bivalvia:Veneridae)( ) 2008-11-13 2008 -MorphologicalCharacters ofthegenus Octopus inKoreanWaters ( ) 2008-11-13 2008 -Controleffcts ofMytilus galloprovincialisonvarious concentrationoftheredtidemicroalgaCochlodiniumpolykrikoidesunderlaboratorycondifions ( ) 2008-11-13 2008 -InfluenceofwatertemperatureandsalinityonfiltrationrateandoxygenconsumptionrateofDosinorbis japonicas (Phacosoma)withvarious shellsizes ( ) 2008-11-13 2008 Pisidium(Neopisidium)coreanum( ) metallothionein ( ) 2008-11-13 2008 ( ) 2008-11-13 2008 ( ) 2008-11-13 2008 -Anage-basedmatrixprojectionmodelforderivingageneralizedsize-dependentmortalityformulationformarinefishspecies ( ) 2008-11-13 2008 -ContrastingrecruitmentoftwoGadoidspecies (Gadus macrocephalus vs Thergrachalcogramma)toKoreancoastalwaters inrelationtoclimatechange( ) 2008-11-13 2008 ( ) 2008-11-13 2008 -2008 ( ) 2008-11-13 2008 -Whatmakes long-termvariationofsquidcatchintheEastSea?( ) 2008-11-13 2008 Arctoscopus japonicus ( ) 2008-11-13 2008 Congermyriaster ( ) 2008-11-13 2008 -ReproductivebiologyofJapaness spearlobsterLinuparus trigonus inJejuisland( ) 2008-11-13 2008 ( ) 2008-11-13 2008 ( ) 2008-11-13 2008 ( ) 2008-11-13 2008 -A new deviceforphotographingfishlarvaeandsmallfishspecimens usingafluidfullphotocellonboard( ) 2008-11-13 2008 Gadus macrocephalus XIII:GeneticdivergenceandpopulationstructureofpacificcodGadus macrocephalus inferredfrommtDNA andmsDNA markers ( ) 2008-11-13 2008 -CrypticgeneticdiversityandphylogeographybetweentwoCoreoleuciscus splendidus haplotypes(teleostei cypriniformes)endemictoKoreainferredfromcompletemitogenomesequences ( ) 2008-11-13 2008 ( ) 2008-11-13 2008 ( ) 2008-11-13 2008 ( ) 2008-11-13 2008 -LED ( ) 2008-11-13 2008 ( ) 2008-11-13 2008 ( ) 2008-11-13 2008 ( ) 2008-11-13 2008 -Enviromentalchallenges inNorwegianfisheries (HaraldEllingsen) 2008-11-13 KAIST WorkshoponSyzygies andGeometry -ExceptionalStewart-Goughplatforms ofgeometricgenus 7http://www mathnetorkr/new_sub04/sub04_01_01php?no=4480&ko_name=Frank-Olaf+Schreyer&paper_id=(Frank-OlafSchreyer) 2008-11-12 KAIST WorkshoponSyzygies andGeometry -Projectivevarieties withnon-birationallinearprojectionhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4384&ko_name=Atsushi+Noma&paper_id=(AtsushiNoma) 2008-11-12 KAIST WorkshoponSyzygies andGeometry -Determinantalequations (GregSmith) 2008-11-12 KAIST WorkshoponSyzygies andGeometry -Completelinearseries onahyperellipticcurvehttp://www mathnetorkr/new_sub04/sub04_01_01php? no=3952&ko_name=%EB%B0%95%EC%9D%98%EC%84%B1&paper_id=&key_name=%EB%B0%95%EC%9D%98%EC%84%B1&key_locale=in(Park Euisung) 2008-11-12 AlgebraicGeometryinEastAsia -Normalprojectivesurfaces admittingnon-isomorphicsurjectiveendomorphisms http://www mathnetorkr/new_sub04/sub04_01_01php?no=4481&ko_name=Noboru+Nakayama&paper_id=(NoboruNakayama) 2008-11-12 AlgebraicGeometryinEastAsia -Q-Gorensteinsmoothings ofanormalprojectivesurfacewithafinitegroupaction(YongnamLee) 2008-11-12 AlgebraicGeometryinEastAsia -Automorphisms ofsurfaces ofgeneraltype includingtheidentityincohomologyhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4706&ko_name=Jin-Xing+Cai&paper_id=(Jin-XingCai) 2008-11-12 AlgebraicGeometryinEastAsia -K3surfaces andmodularforms (Matthias Schuett) 2008-11-12 AlgebraicGeometryinEastAsia -NormalGenerationofNonspecialLineBundles onMultipleCoverings (SeonjaKim) 2008-11-12 AlgebraicGeometryinEastAsia -Spincurves andScorzaquartics (HiromichiTakagi) 2008-11-11 AlgebraicGeometryinEastAsia -Anoptimalboundedness onweak$\bQ$-Fano3-folds (MengChen) 2008-11-11 AlgebraicGeometryinEastAsia -Logcanonicalthresholds ondelPezzohypersurfaces http://www mathnetorkr/new_sub04/sub04_01_01php? no=3735&ko_name=%EB%B0%95%EC%A7%80%ED%9B%88&paper_id=&key_name=%EB%B0%95%EC%A7%80%ED%9B%88&key_locale=in(Park Jihun) 2008-11-11 AlgebraicGeometryinEastAsia -Frobenius morphismandvectorbundles (XiaotaoSun) 2008-11-11 AlgebraicGeometryinEastAsia -QuantumInvarianceunderFlops (Hui-WenLin) 2008-11-11 2008FallColloquium DepartmentofMathematicalSciences KAIST -Manifolds as thefixedpointsets http://www mathnetorkr/new_sub04/sub04_01_01php?no=4712&ko_name=Krzysztof+Pawa%C5%82owski&paper_id=(KrzysztofPawalowski) 2008-11-07 2008FallColloquium DepartmentofMathematicalSciences KAIST -ExoticSymmetries ofManifolds http://www mathnetorkr/new_sub04/sub04_01_01php?no=4712&ko_name=Krzysztof+Pawa%C5%82owski&paper_id=(KrzysztofPawalowski) 2008-11-07 -ApplicationofCs-correctedHigh-resolutionSTEM toSilicateMineralogy(ToshihiroKogure) 2008-11-07 2008FallColloquium DepartmentofMathematicalSciences KAIST -SmithEquivalenceofGroupModules http://www mathnetorkr/new_sub04/sub04_01_01php?no=4712&ko_name=Krzysztof+Pawa%C5%82owski&paper_id=(KrzysztofPawalowski) 2008-11-06 2008 -HPLC-CHEMTAX analysis fordeterminingphytoplanktonbiomass andcompositioninMasanBay( ) 2008-11-06 2008 -Magnesiumisotopes inchlorophyllandcalciteofcoccolithophorids usingmulti-collectorICP-MS (KongtaeRa HiroyukiKitagawa YoshihiroShiraiwa) 2008-11-06 2008 ( ) 2008-11-06 2008 z*( ) 2008-11-06 2008 ( ) 2008-11-06 2008 ( ) 2008-11-06 2008 Dynamiclink ( ) 2008-11-06 2008 ( ) 2008-11-06 2008 -Morphodynamics ofJungangcheontaetidalsandbarattheAsanBaymouth mid-westerncoastofKorea:PreliminaryResults ( ) 2008-11-06 2008 -Glacial-interglacialvariations ofthesubpolarfrontintheEastSeaduringthelast190000years ( ) 2008-11-06 2008 - 55 ( ) 2008-11-06 2008 - 4 ( ) 2008-11-06 2008 ( ) 2008-11-06 2008 ( ) 2008-11-06 2008 -A New deviceforPhotographingfishlarvaeandsmallfishspecimens usingafluidfullphotocellonboard( ) 2008-11-06 2008 ( ) 2008-11-06 2008 -Estimationofcopepodproductioninthecoastalwaters ofKorea:acomparisonofmethods forthemeasurementofcopepodgrowthrate(SeokHyunYoun) 2008-11-06 2008 (Enteromorphaprolifera) ( ) 2008-11-06 2008 ( ) 2008-11-06 2008 -Distribution diversityandecologicalsignificanceofnitrogen-fixers inthenorthwesternPacific(JaeHoonNoh) 2008-11-06 2008 -Cochlodiniumpolykrikoides RedTideDetectionusingtheSpectralClassificationofMODIS DataattheSouthSeaofKorea( ) 2008-11-06 2008 ( ) 2008-11-06 2008 -PhytoplanktongrowthstimulationandnutrientpulsebynaturalrainfallduringspringandsummerinSagamiBay Japan( ) 2008-11-06 2008 -Theoreticalconsiderationandits applicationtoestimatevirus-mediatedbacterialmortalitybasedonobservationofpreservedseawatersamples withTEM ( ) 2008-11-06 2008 -Synechococcus abundanceanddiversityintheEastChinaSeaandEastSea( ) 2008-11-06 2008 -A redescriptionofStrombidinopsis jeokjoJeongetal 2004 aplanktonicoligotrichous ciliate(Ciliophora:oligotrichia)fromthecoastalwateroffsouthernKorea( ) 2008-11-06 2008 -ITS-58S rDNA data Chattonellaantiqua C marina andC ovata :singlespecies?( ) 2008-11-06 2008 : ( ) 2008-11-06 2008 2005 ( ) 2008-11-06 2008 -IntrusionofLow SalinityWaterMass across KoreaStrait(In-SeongHan) 2008-11-06 2008 ( ) 2008-11-06 2008 ( ) 2008-11-06 2008 ( ) 2008-11-06 2008 ( ) 2008-11-06 2008 -Comparisons ofMulti-BeamEchoSounders MosaicImagerywithSideScanSONARinHaborPyungtaEk( ) 2008-11-06 2008 SSTAnomalies ( ) 2008-11-06 2008 MODIS ( ) 2008-11-06 2008 (GDPS) SW ( ) 2008-11-06 2008 (GOCI) ( ) 2008-11-06 2008 ( ) 2008-11-06 2008 ( ) 2008-11-06 2008 -SensitivityAnalyses oftheParticleTrajectoryModelingfortheHebeiSpiritOilSpill( ) 2008-11-06 2008 -WavePropagationCharacteristics intheKyung-giBay Korea(KiRyongKang) 2008-11-06 2008 -OceanresponsetotyphoonNari( ) 2008-11-06 2008 -Impactoftyphoon-inducedSSTcoolingonthecoupledtyphoon-oceanprediction( ) 2008-11-06 2008 -ImpactoftheSurfaceFluxes onSeaFogFormationandPersistence( ) 2008-11-06 2008 ( ) 2008-11-06 2008 :01 ( ) 2008-11-06 2008 -PNU/CMECGCM SST ( ) 2008-11-06 2008 -3 ( ) 2008-11-06 2008 -Theeffects ofmeridionalasymmetricandsymmetricannualcycleonENSO overthetropicalPacific( ) 2008-11-06 2008 ENSO ( ) 2008-11-06 2008 -A studyontheheatfluxinBacksutidalflat southwesterncoastofKorea( ) 2008-11-06 2008 -Balanionmasanensis n sp (Ciliophora:Prostomatea)fromtheCoastalWaters ofKorea:MorphologyandSmallSubunitRibosomalRNA GeneSequence( ) 2008-11-06 2008 (UNCLOS III)76 (CLCS) ( ) 2008-11-06 2008FallColloquium DepartmentofMathematicalSciences KAIST -Lines pinninglines ( ) 2008-10-31 KAIST DiscreteMathSeminar -PriceofAnarchyinTransportationNetworks (Jeong Hawoong) 2008-10-30 CMS-KIASSeminar -Randomembeddings andotherhigh-dimensionalgeometricphenomenahttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4715&ko_name=Nicole+Tomczak-Jaege&paper_id=(NicoleTomczak-Jaegermann) 2008-10-21 CMS-KIASSeminar -Operator-valuedsemicircularelements:attheintersectionofcombinatorics randommatrixtheory andcomplexanalysis http://www mathnetorkr/new_sub04/sub04_01_01php?no=4716&ko_name=Roland+Speicher&paper_id=(RolandSpeicher) 2008-10-21 CMS-KIASSeminar -PeriodicComplexes andGroupActions http://www mathnetorkr/new_sub04/sub04_01_01php?no=4482&ko_name=Alejandro+Adem&paper_id=(AlejandroAdem) 2008-10-21 2008FallColloquium DepartmentofMathematicalSciences KAIST -Mockthetafunctionand (Choi Younseo) 2008-10-17 -RuptureVelocityEstimationofLargeDeep-focus Earthquakes SurroundingJapan( ) 2008-10-17 -Synthesis ofNanoporous Sorbents andApplications forEnvironmentalRemediation( ) 2008-10-10 KAIST DiscreteMathSeminar -Points surroundingtheorigin(Andreas Holmsen) 2008-10-09 2008FallColloquium DepartmentofMathematicalSciences KAIST -Positivemaps andentanglement(Kye Seunghyeok) 2008-10-09 2008FallColloquium DepartmentofMathematicalSciences KAIST -BlackMonday:Whatitwas andhow ithappened?(JinsungYoo) 2008-10-02 2008FallColloquium DepartmentofMathematicalSciences KAIST (P D E WhyandWhat)http://www mathnetorkr/new_sub04/sub04_01_01php? no=4112&ko_name=%EA%B9%80%EC%9A%A9%EC%A0%95&paper_id=&key_name=%EA%B9%80%EC%9A%A9%EC%A0%95&key_locale=in(Kim Yongjung) 2008-09-30 2008FallColloquium DepartmentofMathematicalSciences KAIST -OptimalEstimates ofGradients http://www mathnetorkr/new_sub04/sub04_01_01php? no=2161&ko_name=%EA%B0%95%ED%98%84%EB%B0%B0&paper_id=&key_name=%EA%B0%95%ED%98%84%EB%B0%B0&key_locale=in(Kang Hyeonbae) 2008-09-26 KAIST DiscreteMathSeminar -Maps regularmaps andBelyifunctions http://www mathnetorkr/new_sub04/sub04_01_01php?no=3661&ko_name=%EA%B6%8C%EC%98%81%EC%88%98&paper_id=&key_name=%EA%B6%8C%EC%98%81%EC%88%98&key_locale=in(Kwon Youngsoo) 2008-09-26 Lectures onFinancialMath -Continuous timemodels (fortwohours withintermission)http://www mathnetorkr/new_sub04/sub04_01_01php?no=4717&ko_name=Andrea+Pascucci&paper_id=(AndreaPascucci) 2008-09-24 Lectures onFinancialMath -Lecture2 UniformlyparabolicPDEs (fortwohours withintermission)http://www mathnetorkr/new_sub04/sub04_01_01php?no=4717&ko_name=Andrea+Pascucci&paper_id=(AndreaPascucci) 2008-09-23 Lectures onFinancialMath -Lecture1 Discretetimemodels (fortwohours withintermission)http://www mathnetorkr/new_sub04/sub04_01_01php?no=4717&ko_name=Andrea+Pascucci&paper_id=(AndreaPascucci) 2008-09-22 2008 KAIST -Characteristicclasses fortheexceptionalLiegroups http://www mathnetorkr/new_sub04/sub04_01_01php?no=4718&ko_name=Mamoru+Mimura&paper_id=(MamoruMimura) 2008-09-19 2008 KAIST (Choi Jaehyuck) 2008-09-18 -RemoteSensingApproachforHydrologicApplications ofComplexLakeSystems ( ) 2008-09-12 KAIST DiscreteMathSeminar -Symmetricfunctions andvariations ontableauxhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4719&ko_name=Thomas+Lam&paper_id=(Thomas Lam) 2008-09-09 KAIST DiscreteMathSeminar -Totalpositivityforloopgroups http://www mathnetorkr/new_sub04/sub04_01_01php?no=4719&ko_name=Thomas+Lam&paper_id=(Thomas Lam) 2008-09-08 KAIST BK21Seminar -BoundarybehaviorofSLE(Nam-GyuKang) 2008-09-04 -ContolledReleaseSystems inEnvironmentalRestoration( ) 2008-09-04 KAIST BK21Seminar -A gentleintroductiontoSchramm-Loewnerevolution(Nam-GyuKang) 2008-09-03 ASARC-ConferenceonTransformationGroupTheory -Cohomologyofrealprojectivebundles overarealprojectivespacehttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4424&ko_name=Mikiya+Masuda&paper_id=(MikiyaMasuda) 2008-08-29 ASARC-ConferenceonTransformationGroupTheory -Algebraicrealizationofmanifolds andvectorbundles withgroupactions (HeinerDovermann) 2008-08-29 ASARC-ConferenceonTransformationGroupTheory -Noncompactconformalgroupactions oncompactLorentzmanifolds http://www mathnetorkr/new_sub04/sub04_01_01php?no=4721&ko_name=Yoshinobu+Kamishima&paper_id=(YoshinobuKamishima) 2008-08-29 ASARC-ConferenceonTransformationGroupTheory -Properties ofBotttowers http://www mathnetorkr/new_sub04/sub04_01_01php? no=4471&ko_name=%EC%B5%9C%EC%88%98%EC%98%81&paper_id=&key_name=%EC%B5%9C%EC%88%98%EC%98%81&key_locale=in(Choi Suyoung) 2008-08-29 ASARC-ConferenceonTransformationGroupTheory -A remarkonthedeformationquantization(MyungJunChoi) 2008-08-29 ASARC-ConferenceonTransformationGroupTheory - Stiefel-Whitneyclasses andrepresentations fortheexceptionalLiegroups http://www mathnetorkr/new_sub04/sub04_01_01php?no=4718&ko_name=Mamoru+Mimura&paper_id=(MamoruMimura) 2008-08-29 ASARC-ConferenceonTransformationGroupTheory -Twistedquaternionicheisenberggrouphttp://www mathnetorkr/new_sub04/sub04_01_01php? no=880&ko_name=%EC%8B%A0%EC%A4%80%EA%B5%AD&paper_id=&key_pos=%EC%B6%A9%EB%82%A8%EB%8C%80%ED%95%99%EA%B5%90&key_locale=in(Shin Joonkook) 2008-08-29 ASARC-ConferenceonTransformationGroupTheory -Topologicalentropyofpseudo-Anosovdiffeomorphisms ofgenus twosurfaces http://www mathnetorkr/new_sub04/sub04_01_01php? no=2345&ko_name=%EC%A1%B0%EC%A7%84%ED%99%98&paper_id=&key_name=%EC%A1%B0%EC%A7%84%ED%99%98&key_locale=in(Cho Jinhwan) 2008-08-29 ASARC-ConferenceonTransformationGroupTheory -Circleactions onsymplecticmanifolds (Cho Yunhyung) 2008-08-29 2008ASARCSeminar KAIST -Countinglabelledtrees withgivenindegreesequence(Shin Heesung) 2008-08-21 ASARC -Ellipticcurves andmatrix( ) 2008-08-21 ASARC -Onq-eulernumbers polynomials andrelatedp-adicintegrals ( ) 2008-08-21 ASARC -Traces ofsingularmoduliofarbitrarylevelmodularfunctions ( ) 2008-08-21 ASARC -Class numberproblems ofrealquadraticfields forRichaud-Degerttype( ) 2008-08-20 ASARC -Families ofellipticcurves withprescribedtorsionsubgroups http://www mathnetorkr/new_sub04/sub04_01_01php?no=4071&ko_name=%EC%A0%84%EB%8C%80%EC%97%B4&paper_id=&key_locale=in( ) 2008-08-20 ASARC -Class fieldtheoryofcurves overlocalfields (T Hiranouchi) 2008-08-20 ASARC -Z_pextensions anduniversalnormelements ( ) 2008-08-19 ASARC -Mockmodularforms thatarisefromaq-series summationformulahttp://www mathnetorkr/new_sub04/sub04_01_01php? no=3622&ko_name=%EA%B0%95%EC%88%9C%EC%9D%B4&paper_id=&key_name=%EA%B0%95%EC%88%9C%EC%9D%B4&key_locale=in(Kang Soonyi) 2008-08-19 ASARC -OntheRamanujans cubiccontinuedfractionas modularfunction( ) 2008-08-19 ASARC -A noteonGenocchinumbers andpolynomials ( ) 2008-08-19 ASARC -ConstructionofJacobiforms associatedtoindefinitequadraticforms ( ) 2008-08-19 ASARC -Onthenumberofrestrictedirreduciblefactors ofanpolynomialin$F_q(T)$http://www mathnetorkr/new_sub04/sub04_01_01php? no=3702&ko_name=%EC%95%88%EC%9E%AC%ED%98%84&paper_id=&key_name=%EC%95%88%EC%9E%AC%ED%98%84&key_locale=in( ) 2008-08-19 ASARC -Langlands FunctorialityConjecturehttp://www mathnetorkr/new_sub04/sub04_01_01php?no=964&ko_name=%EC%96%91%EC%9E%AC%ED%98%84&paper_id=&key_locale=in( ) 2008-08-18 ASARC -Class groups ofglobalfunctionfields http://www mathnetorkr/new_sub04/sub04_01_01php?no=1337&ko_name=%EC%9D%B4%EC%9C%A4%EC%A7%84&paper_id=&key_name=%EC%9D%B4%EC%9C%A4%EC%A7%84&key_locale=in( ) 2008-08-18 ASARC -EvaluationoftheDedekindzetafunctions ats=-1ofsimplestquarticfield( ) 2008-08-18 TOPOLOGY WORKSHOP - Loopspacestructures ofsomegeometricgroups II(YongjinSong) 2008-08-14 TOPOLOGY WORKSHOP -Freeactions offinitegroups onthe3-dimensionalnilmanifold(JoonkookShin) 2008-08-14 TOPOLOGY WORKSHOP -AppliedTopologyandComputerScience(Sang-EonHan) 2008-08-14 TOPOLOGY WORKSHOP -Is aPoincaredualitygroupnecessarilythefundamentalgroupofan(YanghyunByun) 2008-08-14 TOPOLOGY WORKSHOP -IntroductiontoA-infinityalgebraandits deformations (Cheol-HyunCho) 2008-08-14 TOPOLOGY WORKSHOP -IntroductiontoToricTopologyII(DongYoupSuh) 2008-08-14 TOPOLOGY WORKSHOP -Braidgroups andrelatedgroups II(SangJinLee) 2008-08-13 TOPOLOGY WORKSHOP -Extendedhyperbolicspaceandits problems II(YunhiCho) 2008-08-13 TOPOLOGY WORKSHOP -IntroductiontoToricTopologyI(DongYoupSuh) 2008-08-12 TOPOLOGY WORKSHOP -Extendedhyperbolicspaceandits problems I(YunhiCho) 2008-08-12 TOPOLOGY WORKSHOP -Curvecomplexandlow dimensionaltopology(SungbokHong) 2008-08-12 TOPOLOGY WORKSHOP -Braidgroups andrelatedgroups I(SangJinLee) 2008-08-12 TOPOLOGY WORKSHOP -Liegroups Buraurepresentation andnon-conjugatebraids withthesameclosurelinkhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4618&ko_name=Stoimenow%2C+Alexander&paper_id=&key_name=Stoimenow&key_locale=in(Alexander Stoimenow) 2008-08-12 TOPOLOGY WORKSHOP -Loopspacestructures ofsomegeometricgroups I(YongjinSong) 2008-08-12 PacificRim ComplexGeometryConference(PRCG2008) -Frobenius manifolds andextendedaffineWeylgroups http://www mathnetorkr/new_sub04/sub04_01_01php?no=4723&ko_name=Dafeng+ZUO&paper_id=(DafengZUO) 2008-08-01 PacificRim ComplexGeometryConference(PRCG2008) -Symplecticvarieties andPoissondeformations http://www mathnetorkr/new_sub04/sub04_01_01php?no=4724&ko_name=Yoshinori+NAMIKAWA&paper_id=(YoshinoriNAMIKAWA) 2008-08-01 PacificRim ComplexGeometryConference(PRCG2008) -TheCalabiflow http://www mathnetorkr/new_sub04/sub04_01_01php?no=4725&ko_name=Weiyong+HE&paper_id=(WeiyongHE) 2008-07-31 PacificRim ComplexGeometryConference(PRCG2008) -Characteristicclasses andsymplecticrepresentations http://www mathnetorkr/new_sub04/sub04_01_01php?no=4726&ko_name=Shigeyuki+MORITA&paper_id=(ShigeyukiMorita) 2008-07-31 PacificRim ComplexGeometryConference(PRCG2008) -Perelmans W-functionandstabilityofKahler-Ricciflow http://www mathnetorkr/new_sub04/sub04_01_01php?no=4727&ko_name=Xiaohua+Zhu&paper_id=(XiaohuaZhu) 2008-07-31 PacificRim ComplexGeometryConference(PRCG2008) -L2extensionofadjointlinebundlesections (DanoKIM) 2008-07-31 PacificRim ComplexGeometryConference(PRCG2008) -Homologicalmirrorsymmetryhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4324&ko_name=Ruan%2C+Wei-Dong&paper_id=&key_name=Ruan&key_locale=in(WeidongRUAN) 2008-07-30 PacificRim ComplexGeometryConference(PRCG2008) -Rationalhomologyprojectiveplanes (JongHaeKEUM) 2008-07-30 PacificRim ComplexGeometryConference(PRCG2008) -Fakehermitiansymmetricspaces http://www mathnetorkr/new_sub04/sub04_01_01php?no=4521&ko_name=Sai+Kee+Yeung&paper_id=(SaiKeeYeung) 2008-07-29 PacificRim ComplexGeometryConference(PRCG2008) -Onquotients ofSteinmanifolds byproperlydiscontinuous actions http://www mathnetorkr/new_sub04/sub04_01_01php?no=4728&ko_name=Bo-Yong+CHEN&paper_id=(Bo-YongChen) 2008-07-29 PacificRim ComplexGeometryConference(PRCG2008) -Endomorphisms ofnormalprojectivevarieties http://www mathnetorkr/new_sub04/sub04_01_01php?no=4729&ko_name=De-Qi+Zhang&paper_id=(De-QiZhang) 2008-07-29 PacificRim ComplexGeometryConference(PRCG2008) -Boundaries ofcycledomains associatedtoflagvarieties (JaehyunHONG) 2008-07-29 PacificRim ComplexGeometryConference(PRCG2008) -Analytictorsionandautomorphicforms http://www mathnetorkr/new_sub04/sub04_01_01php?no=4730&ko_name=Ken-ichi+Yoshikawa&paper_id=(Ken-IchiYoshikawa) 2008-07-28 PacificRim ComplexGeometryConference(PRCG2008) -Connectingcertainrigidbirationalnon-homeomorphicCalabi-Yauthreefolds viaHilbertscheme(Nam-HoonLee) 2008-07-28 PacificRim ComplexGeometryConference(PRCG2008) -LocalGromov-WittenInvariants ofSpinCurves (JunhoLEE) 2008-07-28 PacificRim ComplexGeometryConference(PRCG2008) -Finitegroupactions onhomotopyK3surfaces (JinHongKIM) 2008-07-28 2008ASARCSeminar KAIST -ModularmethodandDiophantineequations http://www mathnetorkr/new_sub04/sub04_01_01php?no=4731&ko_name=Akos+Pinter&paper_id=(Akos Pinter) 2008-07-25 KIAS2008 -Floertheoryintoricmanifolds VI(OhYong-Geun) 2008-07-18 KIAS2008 -Floertheoryintoricmanifolds V (OhYong-Geun) 2008-07-11 -2002 -C() 2008-07-08 -2002 -B() 2008-07-08 -2002 -A () 2008-07-08 I( ) 2008-07-08 II( ) 2008-07-08 -SpecialConsiderationontheRADARSATRepeat-pass SARInterferometry( ) 2008-07-08 -Reviews inCrystalstructures ofsomedoublehydroxideminerals ( ) 2008-07-08 -SoilPollutionandManagementI( ) 2008-07-08 -SoilPollutionandManagementII( ) 2008-07-08 -MineralogicalCharacteristics onGeneticEnvironmentoftheUpperJurassicSolnhofenLimestoneofSouthernGermany( ) 2008-07-08 -AluminumSpeciationinSoilSolutionThroughDifferntialKineticReactions withFerron( ) 2008-07-08 -SARInterferometryPhaseUnwrapping:Branchcut Minimumdiscontinuity MinimumLp-norm ( ) 2008-07-08 -SAR ( ) 2008-07-08 -Influences ofsorptionandspeciationofheavymetalonthemicrobialbiodegradativeactivityoforganiccontaminants insoils ( ) 2008-07-08 -Applications ofCrredoxgeochemistry(ppt)( ) 2008-07-08 -InterferometricSyntheticApertureRadar(InSAR)Studies ofVolcanoes andEarthquakes inAlaska(PPT)(Dr ZhongLu) 2008-07-08 38 -A () 2008-07-08 38 -B() 2008-07-08 38 -C() 2008-07-08 38 -D () 2008-07-08 KIAS2008 -Floertheoryintoricmanifolds IV (OhYong-Geun) 2008-07-04 2008 KAIST -Combinatorics ofgeneralizedq-Eulernumbers ( ) 2008-07-03 KIAS2008 -Floertheoryintoricmanifolds III(OhYong-Geun) 2008-06-27 2008Ewha-KMSInternationalWorkshoponCryptography -CMACandHybridEncryptionIIhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4732&ko_name=Kaoru+Kurosawa&paper_id=(KaoruKurosawa) 2008-06-20 2008Ewha-KMSInternationalWorkshoponCryptography -Thesearchforpairingfriendlyellipticcurves (MichaelScott) 2008-06-20 2008Ewha-KMSInternationalWorkshoponCryptography -DiscreteLogarithmProblemonFiniteFields http://www mathnetorkr/new_sub04/sub04_01_01php? no=1842&ko_name=%EC%B2%9C%EC%A0%95%ED%9D%AC&paper_id=&key_name=%EC%B2%9C%EC%A0%95%ED%9D%AC&key_locale=in(Cheon Junghee) 2008-06-20 2008Ewha-KMSInternationalWorkshoponCryptography -Fairness andCryptographyhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4734&ko_name=Moni+Naor&paper_id=(MoniNaor) 2008-06-20 2008Ewha-KMSInternationalWorkshoponCryptography -Cryptanalysis vs ProvableSecurityhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4740&ko_name=Phong+Q +Nguyen&paper_id=(PhongQ Nguyen) 2008-06-20 2008Ewha-KMSInternationalWorkshoponCryptography -OnPairingFriendlyEllipticCurves andFields http://www mathnetorkr/new_sub04/sub04_01_01php?no=4742&ko_name=Igor+Shparlinski&paper_id=(IgorShparlinski) 2008-06-19 2008Ewha-KMSInternationalWorkshoponCryptography -CMACandHybridEncryptionIhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4732&ko_name=Kaoru+Kurosawa&paper_id=(KaoruKurosawa) 2008-06-19 2008Ewha-KMSInternationalWorkshoponCryptography -ImplementingCryptographicPairings (MichaelScott) 2008-06-19 2008Ewha-KMSInternationalWorkshoponCryptography -Hermites ConstantandLatticeReductionhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4740&ko_name=Phong+Q +Nguyen&paper_id=(PhongQ Nguyen) 2008-06-19 ToricTopologyWorkshopKAIST 2008 -Quasitoricmanifolds http://www mathnetorkr/new_sub04/sub04_01_01php?no=4758&ko_name=Victor+Buchstaber&paper_id=(VictorBuchstaber) 2008-06-13 2008ASARCSeminar KAIST -Extensions of(phi Gamma)-modules ( ) 2008-06-13 2008ASARCSeminar KAIST -p-adicconstructionofarithmeticunits IIIIII( ) 2008-06-13 2008ASARCSeminar KAIST -Universaldeformationrings IIIIII(HanRin) 2008-06-13 ( ) 2008-06-13 2008ASARCSeminar KAIST -Theactionoftheabsolutegalois grouponabelianvarieties ( ) 2008-06-12 KAIST III( ) 2008-06-12 KAIST IV ( ) 2008-06-12 KAIST V ( ) 2008-06-12 ToricTopologyWorkshopKAIST 2008 -Moment-anglecomplexes andapplications http://www mathnetorkr/new_sub04/sub04_01_01php?no=4758&ko_name=Victor+Buchstaber&paper_id=(VictorBuchstaber) 2008-06-11 2008 KAIST -Katos smoothingeffects forthe1D interfacewater-waveproblem( ) 2008-06-11 KAIST I( ) 2008-06-11 KAIST II( ) 2008-06-11 ToricTopologyWorkshopKAIST 2008 -Minkowskisumandsimplepolytopes http://www mathnetorkr/new_sub04/sub04_01_01php?no=4758&ko_name=Victor+Buchstaber&paper_id=(VictorBuchstaber) 2008-06-09 2008 KAIST -RotationalStokes waves andtheirhydrodynamicstability( ) 2008-06-09 ToricTopologyWorkshopKAIST 2008 -ToricTopologyofStasheffPolytopes http://www mathnetorkr/new_sub04/sub04_01_01php?no=4758&ko_name=Victor+Buchstaber&paper_id=(VictorBuchstaber) 2008-06-06 KIAS2008 -Floertheoryintoricmanifolds I(OhYong-Geun) 2008-06-06 ToricTopologyWorkshopKAIST 2008 -Face-polynomials ofsimplepolytopes andapplications http://www mathnetorkr/new_sub04/sub04_01_01php?no=4758&ko_name=Victor+Buchstaber&paper_id=(VictorBuchstaber) 2008-06-05 ( ) 2008-05-30 2008 -OntherelationshipbetweenENSO andtheannualcycleamplitudeintheeasternequatorialPacific( ) 2008-05-29 2008 -Changes intheNorthPacificSSTvariabilityunderglobalwarming( ) 2008-05-29 2008 ( ) 2008-05-29 2008 ( ) 2008-05-29 2008 ( ) 2008-05-29 2008 ( ) 2008-05-29 2008 ( ) 2008-05-29 2008 ( ) 2008-05-29 2008 ( ) 2008-05-29 2008 ( ) ( ) 2008-05-29 2008 ( ) 2008-05-29 2008 -KODOS :GIS ( ) 2008-05-29 2008 ( ) 2008-05-29 2008 ( ) 2008-05-29 2008 ( ) 2008-05-29 2008 -SeaPrince ( ) 2008-05-29 2008 ( ) 2008-05-29 2008 ( ) 2008-05-29 2008 ( ) 2008-05-29 2008 Urine ( ) 2008-05-29 2008 ( ) 2008-05-29 2008 ( ) 2008-05-29 2008 ( ) 2008-05-29 2008 ( ) 2008-05-29 2008 ( ) 2008-05-29 2008 ( ) 2008-05-29 2008 ( ) 2008-05-29 2008 -HebeiSpirit ( ) 2008-05-29 2008 ( ) 2008-05-29 TeXWorkshop:IntermediateLaTeXCourse -LaTeX :How towriteaLaTeX package ( ) 2008-05-24 TeXWorkshop:IntermediateLaTeXCourse ( ) 2008-05-24 TeXWorkshop:IntermediateLaTeXCourse -TeX ( ) 2008-05-24 TeXWorkshop:IntermediateLaTeXCourse PDF ( ) 2008-05-24 TeXWorkshop:IntermediateLaTeXCourse ( ) 2008-05-24 2008ASARCSeminar KAIST -Etalesheaf l-adicsheaf derivedcategoryofl-adicsheaf 6operations onthederivedcategory perverset-structure VerdierdualityIIhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4754&ko_name=Lei+Fu&paper_id=(LeiFu) 2008-05-24 2008ASARCSeminar KAIST -p-adicmonodromyandRiemann-HilbertcorrespondenceI(DongUkLee) 2008-05-24 2008ASARCSeminar KAIST -p-adicmonodromyandRiemann-HilbertcorrespondenceII(DongUkLee) 2008-05-24 2008 KAIST -BraidGoups MappingClass Groups andLoopSpaces ( ) 2008-05-23 2008ASARCSeminar KAIST -Etalesheaf l-adicsheaf derivedcategoryofl-adicsheaf 6operations onthederivedcategory perverset-structure VerdierdualityIhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4754&ko_name=Lei+Fu&paper_id=(LeiFu) 2008-05-23 2008ASARCSeminar KAIST -Monodromyandlocalsystems regularholonomicD-modules Riemann-Hilbertcorrespondence FouriertransformationII(ByungheupJun) 2008-05-23 2008ASARCSeminar KAIST -Derivedcategory t-structure Perversesheaf(MyungSung) 2008-05-22 2008ASARCSeminar KAIST -Monodromyandlocalsystems regularholonomicD-modules Riemann-Hilbertcorrespondence FouriertransformationI(ByungheupJun) 2008-05-22 -DistributionoftheWorld`s OilandGas SourceRocks inSpaceandTime(PeterJ McCabe) 2008-05-19 2008ASARCSeminar KAIST -OptimalQueryComplexityBounds forFindingGraphs (Kim JeongHan) 2008-05-16 ( ) 2008-05-16 2008ASARCSeminar KAIST -Indivisibilityofclass numbers ( ) 2008-05-09 ( ) 2008-05-09 2008 KAIST -AlgebraicSurfaces ofGeometricGenus Zerohttp://mathsogangackr/ynlee/( ) 2008-05-02 -Themass balnaceofworld`s largestglacialbasin:TheStoryfromSatellites ( ) 2008-05-02 2008 - 11 ( ) 2008-04-26 2008 ( ) 2008-04-26 2008 http://www mathnetorkr/new_sub04/sub04_01_01php?no=3937&ko_name=%EC%9D%B4%EA%B8%B0%EC%95%94&paper_id=&key_name=%EC%9D%B4%EA%B8%B0%EC%95%94&key_locale=in(Lee Kiahm) 2008-04-26 2008 -Recentresults inKinetictheoryhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4233&ko_name=%ED%99%A9%ED%98%95%EC%A3%BC&paper_id=&key_name=%ED%99%A9%ED%98%95%EC%A3%BC&key_locale=in(Hwang Hyungju) 200804-26 2008 -Onthesyzygies ofquasi-completeintersectionspacecurves http://www mathnetorkr/new_sub04/sub04_01_01php? no=2343&ko_name=%EC%B5%9C%EC%98%81%EC%9A%B1&paper_id=&key_name=%EC%B5%9C%EC%98%81%EC%9A%B1&key_locale=in(Choi Youngook) 2008-04-26 2008 -Discreteness properties oftranslationnumbers inGarsidegroups http://www mathnetorkr/new_sub04/sub04_01_01php? no=4330&ko_name=%EC%9D%B4%EC%83%81%EC%A7%84&paper_id=&key_name=%EC%9D%B4%EC%83%81%EC%A7%84&key_locale=in(Lee Sangjin) 2008-04-26 2008 -Mathematicalmodels infinancehttp://www mathnetorkr/new_sub04/sub04_01_01php?no=1051&ko_name=%EC%9C%84%EC%9D%B8%EC%88%99&paper_id=&key_name=%EC%9C%84%EC%9D%B8%EC%88%99&key_locale=in(Wee Insuk) 2008-04-26 2008 -Geometricmeasures andgeometricinequalities http://www mathnetorkr/new_sub04/sub04_01_01php?no=4762&ko_name=Jiazu+Zhou&paper_id=(JiazuZhou) 2008-04-26 2008 KAIST -RigidityPhenomenainBoundedSymmetricDomains ArisingfromBoundedHolomorphicFunctionhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4456&ko_name=Ngaiming+Mok&paper_id=(NgaimingMOK) 2008-04-25 -ProtectionforsurfacewaterPollution( ) 2008-04-24 2008ASARCSeminar KAIST -Productformulas arisefrombilateralbasichypergeometricseries (Kang Soonyi)http://www mathnetorkr/new_sub04/sub04_01_01php? no=3622&ko_name=%EA%B0%95%EC%88%9C%EC%9D%B4&paper_id=&key_name=%EA%B0%95%EC%88%9C%EC%9D%B4&key_locale=in2008-04-18 -NanoscaleIronforTreatmentofChlorinatedHydrocarbons ( ) 2008-04-18 RichardP Stanley (MIT)( Symmetricfunctions)IV http://www mathnetorkr/new_sub04/sub04_01_01php?no=2486&ko_name=Richard+P +Stanley&paper_id=Stanley(RichardP Stanley) 2008-04-13 RichardP Stanley (MIT)( Symmetricfunctions)IIIhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=2486&ko_name=Richard+P +Stanley&paper_id=Stanley(RichardP Stanley) 2008-04-11 RichardP Stanley (MIT)-Increasinganddecreasingsubsequences http://www mathnetorkr/new_sub04/sub04_01_01php?no=2486&ko_name=Richard+P +Stanley&paper_id=Stanley(RichardP Stanley) 2008-04-11 -Siteeffectobservation modeling andtheirinclusioninbuildingcodes (Dr FranciscoJosechavez-Garcia) 2008-04-11 RichardP Stanley (MIT)( Symmetricfunctions)IIhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=2486&ko_name=Richard+P +Stanley&paper_id=Stanley(RichardP Stanley) 2008-04-09 RichardP Stanley (MIT)( Symmetricfunctions)Ihttp://www mathnetorkr/new_sub04/sub04_01_01php?no=2486&ko_name=Richard+P +Stanley&paper_id=Stanley(RichardP Stanley) 2008-04-09 -Sounds oftheSouthernOcean:HydroacusticmonitoringintheBransfieldStrait Antarctica( ) 2008-03-14 ProjectiveandComputationalAlgebraicGeometry -Projections ofrationalnromalscrolls II(Brodmann) 2008-02-14 ProjectiveandComputationalAlgebraicGeometry -Themaximumnumberofsingularpoints onrationalhomologyprojectiveplanes ( ) 2008-02-14 ProjectiveandComputationalAlgebraicGeometry -Thedegree-complexityofthedefiningidealofasmoothintegralcurve( ) 2008-02-14 ProjectiveandComputationalAlgebraicGeometry -Somecomputationalaspects ofalgebraicgeometryIII(Schenzel) 2008-02-14 ProjectiveandComputationalAlgebraicGeometry -Somecomputationalaspects ofalgebraicgeometryII(Schenzel) 2008-02-13 ProjectiveandComputationalAlgebraicGeometry -Syzygies ofsmoothprojectivevarieties (afterEin-Lazarsfeld)(Chan) 2008-02-13 ProjectiveandComputationalAlgebraicGeometry -Holomorphicmaps fromcompacthomogeneous Kaehlerspaces ontocomplexmanifolds (LauChiHin) 2008-02-13 ProjectiveandComputationalAlgebraicGeometry -Projections ofrationalnormalscrolls Ihttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4759&ko_name=Markus+Peter+Brodman&paper_id=(Markus Brodmann) 2008-02-12 ProjectiveandComputationalAlgebraicGeometry -Somecomputationalaspects ofalgebraicgeometryI(Schenzel) 2008-02-12 ProjectiveandComputationalAlgebraicGeometry -OnSeshadriconstantandlocalpositivity(KunghoChan) 2008-02-12 ProjectiveandComputationalAlgebraicGeometry -Classificationofprojectivevarieties ofalmostminimaldegree( ) 2008-02-12 EastAsiaNumber TheoryConference -OntheImplementationofTatePairings (SoonhakKwon) 2008-01-23 EastAsiaNumber TheoryConference -Ananalogueofthediscriminantfunctionforcongruencesubgroupandits applicationtotheextremalquasimodularforms (HiroyukiTsutsumi) 2008-01-23 EastAsiaNumber TheoryConference -PrimeSolutions toQuadraticFquations http://www mathnetorkr/new_sub04/sub04_01_01php?no=4757&ko_name=Jianya+Liu&paper_id=(JianyaLiu) 2008-01-23 EastAsiaNumber TheoryConference -ExtendedGauss AGM andisogenous formulas ofmodularforms http://www mathnetorkr/new_sub04/sub04_01_01php?no=4756&ko_name=Hironori+Shiga&paper_id=(HironoriShiga) 2008-01-23 EastAsiaNumber TheoryConference -Modularunits anddivisorclass groups ofthemodularcurves $X_1(N)$http://www mathnetorkr/new_sub04/sub04_01_01php?no=4755&ko_name=Yifan+Yang&paper_id=(YifanYang) 2008-01-23 EastAsiaNumber TheoryConference -Calculationof$l$-adiclocalFouriertransformations http://www mathnetorkr/new_sub04/sub04_01_01php?no=4754&ko_name=Lei+Fu&paper_id=(LeiFu) 2008-01-23 EastAsiaNumber TheoryConference -Onthep-adicL-functions formodularforms (MasatakaChida) 2008-01-23 EastAsiaNumber TheoryConference -Ramakrishna-KhareSystems inHigherWeights (Yih-JengYU) 2008-01-23 EastAsiaNumber TheoryConference -ThefirstsignchangeofFouriercoefficients focuspforms (YoungJuChoie) 2008-01-23 Ajou-KAIST-POSTECH InternationalConferenceinFinanceandMathematics -OnaHamilton-Jacobi-BellmanEquationRelatedtoaStochasticPeriodicModel(KijungLee) 2008-01-23 Ajou-KAIST-POSTECH InternationalConferenceinFinanceandMathematics -Ensuringfairness whenpoolingtrades inaquantitativeinvestmentprocess (ColmOCinneide) 2008-01-23 Ajou-KAIST-POSTECH InternationalConferenceinFinanceandMathematics -StrongViability Arbitrage andEquilibrium:aUnifiedApproachtoIncomeTaxes andTransactionCosts (DongChulWon) 2008-01-23 Ajou-KAIST-POSTECH InternationalConferenceinFinanceandMathematics -PayoutPolicyandCash-Flow Uncertainty(Jong-BomCHAY) 2008-01-23 Ajou-KAIST-POSTECH InternationalConferenceinFinanceandMathematics -Co-integrationinCrudeOilComponents andthePricingofCrackSpreadOptions http://www mathnetorkr/new_sub04/sub04_01_01php?no=4752&ko_name=Jin-Chuan+Duan&paper_id=(Jin-ChuanDuan) 2008-01-23 Ajou-KAIST-POSTECH InternationalConferenceinFinanceandMathematics -Minimizingadown-sideriskprobabilityandrisk-sensitiveassetallocationunderpartialinformationhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4751&ko_name=Hideo+Nagai&paper_id=(Hideo NAGAI) 2008-01-23 Ajou-KAIST-POSTECH InternationalConferenceinFinanceandMathematics -EquilibriumEquityPremiumandInterestRateofaLarge-FirmEconomyinthePresenceofMoralHazard(JaeyoungSung) 2008-01-23 Ajou-KAIST-POSTECH InternationalConferenceinFinanceandMathematics -AnAlternativeNumericalApproachforValuationofAmericanOptions:A SimpleIterationMethod(InJoonKim) 2008-01-23 Ajou-KAIST-POSTECH InternationalConferenceinFinanceandMathematics -StrategicTradingofInformedTraderwithMonopolyonShort-andLong-LivedInformation(SungsubChoi) 2008-01-23 Ajou-KAIST-POSTECH InternationalConferenceinFinanceandMathematics -HierarchicalContract FirmSize andPaySensitivity(Hyeng-keunKoo) 2008-01-23 Ajou-KAIST-POSTECH InternationalConferenceinFinanceandMathematics -TwilightFalls ontheLimitOrderBook:EndogeneityandtheDemiseofBrokerIdentity(PeterSwan) 2008-01-23 Ajou-KAIST-POSTECH InternationalConferenceinFinanceandMathematics -FundamentalTheoremofWelfareEconomics (XuhuWan) 2008-01-23 EastAsiaNumber TheoryConference -Towerofthemaximalabelianextensions oflocalfields andtheirapplication(XuFei) 2008-01-22 EastAsiaNumber TheoryConference -Thetransfermaps formotiviccohomologyandNesternko-Suslintheroem(SungMyung) 2008-01-22 EastAsiaNumber TheoryConference -$K_{2i}(O_F)$for$Z_p$-extensionhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4750&ko_name=HouRong+Qin&paper_id=(HourongQin) 2008-01-22 EastAsiaNumber TheoryConference -Regularpositiveternaryquadraticforms (Byeong-KweonOh) 2008-01-22 EastAsiaNumber TheoryConference -Congruences betweenextremalmodularforms andthetaseries ofspecialtypes modulopowers of2and3http://www mathnetorkr/new_sub04/sub04_01_01php?no=4749&ko_name=Masao+Koike&paper_id=(MasaoKoike) 2008-01-22 EastAsiaNumber TheoryConference -Vahlens Involutionandq-sereis identities (JoonYoupLee) 2008-01-22 EastAsiaNumber TheoryConference -Onthecoefficients ofcertainfamilyofmodularequations (NamMinKim) 2008-01-22 EastAsiaNumber TheoryConference - TruncatedEulerSystems (SoogilSeo) 2008-01-21 EastAsiaNumber TheoryConference -ControlTheorems forAbelianVarieties overGlobalFunctionFields (Ki-SengTan) 2008-01-21 EastAsiaNumber TheoryConference -A geometricproofofMordells conjectureforfunctionfields (KezhengLI) 2008-01-21 EastAsiaNumber TheoryConference -Thenon-existenceofcertainmod2Galois representations ofsomesmallquadraticfields http://www mathnetorkr/new_sub04/sub04_01_01php?no=4562&ko_name=Yuichiro+Taguchi&paper_id=(YuichiroTaguchi) 2008-01-21 EastAsiaNumber TheoryConference -OnMotivicTranscendenceTheoryinPositiveCharacteristichttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4650&ko_name=Jing+Yu&paper_id=(JingYu) 2008-01-21 EastAsiaNumber TheoryConference -OnaLocal-GlobalPropertyofAlgebraicDynamics http://www mathnetorkr/new_sub04/sub04_01_01php?no=4748&ko_name=Liang-Chung+Hsia&paper_id=(Liang-ChungHsia) 2008-01-21 1-DayWorkshopfor Frontiers inHigh-PressureResearch2007 -Diamond-anvilcellhigh-pressureresearchatPohangAcceleratorLaboratory(Prof YongjaeLee) 2007-11-10 Backtotopofpage 2007 KAIST 2007 -LiquidityPremia TransactionConsts andRelatedTopics ( ) 2007-12-22 KAIST 2007 -Quant ( ) 2007-11-28 KAIST 2007 -PartialDifferentialEquations WhyandWhathttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4112&ko_name=%EA%B9%80%EC%9A%A9%EC%A0%95&paper_id=&key_name=%EA%B9%80%EC%9A%A9%EC%A0%95&key_locale=in(Kim Yongjung) 2007-11-28 -Behaviorofparticulatematerials -Gas hydratefromLaboratorytoField( ) 2007-11-19 ( ) 2007-11-16 KAIST 2007 -BrainandMind:Whatis thebraintothebody?( ) 2007-11-14 -PolarimetricSARTechniques EarthquakePrecursorandTsunamiSignatures (Prof WolfganM Boerner) 2007-11-12 1-DayWorkshopfor Frontiers inHigh-PressureResearch2007 -Theeffectofdynamiccompressiononphasetransformation:SolidificationofwaterandcrystalgrowthoficeVIusingdynamicdiamondanvilcelltechnique(Dr GeunWooLee) 2007-11-10 1-DayWorkshopfor Frontiers inHigh-PressureResearch2007 -NovelAspects oftheperovskite-postperovskitephasetransitionandits relevancefortheEarth(Dr OliverTschauner) 2007-11-10 KAIST 2007 -DeBruijn-Newman ( ) 2007-11-09 2007 ( ) 2007-11-08 2007 PCBs ( ) 2007-11-08 2007 DMS (dimethylsulfide) ( ) 2007-11-08 2007 -PathwayandDilutionDynamics ofPower-PlantThermalEffluentwithinaTidalBay( ) 2007-11-08 2007 -NorecentuptakeofanthropogenicCO2bytheEast/JapanSea( ) 2007-11-08 2007 ( ) 2007-11-08 2007 -Distributionpatterns ofchalcogens (S Se Te and210Po)invarious tissues ofthepacificflyingsquid Todarodes pacificus (HanneloreWaska) 2007-11-08 2007 (DOC) (DON) ( ) 2007-11-08 2007 -Sedimenttraprecords ofalkenones fromtheEastSea( ) 2007-11-08 2007 -AnapplicationoftheECOMSED modeltotheSaemangeumarea:Wintertimesedimenttransport( ) 2007-11-08 2007 ( ) 2007-11-08 2007 -GeoacousticP-wavevelocitymodelforwesternSouthKoreaPlateau EastSea:significanceofbasementrocks anddeepdrillingcoresedimentdata( ) 2007-11-08 2007 ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 -EffectofairtemperatureandmarineenvironmentonkrillandsalpstockintheAtlanticandIndiansectors oftheSouthernOcean( ) 2007-11-08 2007 -ClimateChangeImpacts onAntarcticMarineEcosystemandKrillFishery(HyoungChulShim) 2007-11-08 2007 (LED) ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 -CarbonFluxControlledbyPrimaryProducerinLocalEstuarySystem(KwangyangBay)( ) 2007-11-08 2007 -Relationships betweenencystmentandvegetativepopulationofaplanktonicciliate Strombidiumcapitatum( ) 2007-11-08 2007 ( ) 2007-11-08 2007 (plastidthief) : Dinophysis caudata( ) 2007-11-08 2007 -RapiddetectionandquantificationoftoxicdinoflagellateKarlodiniumveneficum(Dinophyceae)fromenvironmentalsamples byusingreal-timePCR( ) 2007-11-08 2007 Gymnodiniumcatenatum(Graham) ( ) 2007-11-08 2007 -Growthofdinoflagellates CeratiumfurcaandCeratiumfusus inSagamiBay Japan:Theroleofnutrients ( ) 2007-11-08 2007 -2007 Cochlodiniumpolykrikoides ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 -UnstableEffects oftheDepthonNumericalModelinginaCoastalRegion(ChulHoonHong SeYoungPark) 2007-11-08 2007 -Effects ofanew air-seamomentumfluxparameterizationontyphoon stormsurge andwindwavemodeling(IlJuMoon) 2007-11-08 2007 ( ) 2007-11-08 2007 -Timeandspatialvariations offreshwaterregionbyriverrunoffinasmallbaywiththepassageofatyphoonusingPOM (SeYoungPark ChulHoonHong) 2007-11-08 2007 ( ) 2007-11-08 2007 -Ananalyticalsolutionforthelocalsusopendedsedimentprofileinathree-layeredsea(KyungTaeJung) 2007-11-08 2007 -EvolutionofTurbulenceintheOceanMixedLayerRespondingtotheStabilizingBuoyancyFluxSimulatedbyLES ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 ( ) ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 -EddyHeatTransportoftheNorthPacificSimulatedbyandEddy-ResolvingOGCM ( ) 2007-11-08 2007 -Changes inleadingENSO modes associatedwiththelate1970s climateshift( ) 2007-11-08 2007 -135˚E ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 -Observationanddynamics ofstrongdeepcurrents nearDokdo(YunBaeKim KyungIlChang KuhKim JaeHakLee) 2007-11-08 2007 -Submeso-scaleVariabilities alongtheCamelliaLineintheTsushima/KoreaStraits (T Nakakohara) 2007-11-08 2007 -Effectofthealong-straitwindonthetransportthroughtheKorea/TsushimaStraitinSeptember(JaeHongMoon) 2007-11-08 2007 -MonitoringtheIntrusionoflow salinitywatermass across JejuStraitinsummer 2007( ) 2007-11-08 2007 ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 (TissueResidueCriteria) ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 10 ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 -Wastewatertreatmentplants (WWTPs)as asourceofsedimentcontaminationbydioxin-likeandestrogenicpollutants inasemi-enclosedbayinKorea( ) 2007-11-08 2007 ( ) 2007-11-08 2007 -EnantiomericCompositionofChiralPolychlorinatedBiophenyls inMarineSpecies andSedimentfromMasanBay( ) 2007-11-08 2007 ( ) 2007-11-08 2007 - 10 ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 - 10 ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 ( P Yund) 2007-11-08 2007 -CellcycleofHeterosigmaakashiwowithspecialreferencetoverticalmigrationbehavior( ) 2007-11-08 2007 ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 (Bioturbation) ( ) 2007-11-08 2007 -Increaseinthesediment-waterinterfaceduetomacrofaunalburrowingandits effects onoxygendistributionwithintidalsediments ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 -ARGO ( ) 2007-11-08 2007 - Argo ( ) 2007-11-08 2007 -ARGO dataintheEastSeaforOperationalOceanography(ShreeRamPrakya) 2007-11-08 2007 -Themixedlayerproperties intheNorthwestPacificanalyzedwithArgodata( ) 2007-11-08 2007 ( ) 2007-11-08 2007 - Argo ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 -AnoperationalstormsurgepredictionsystemintheKoreancoasts ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 ( ) 2007-11-08 2007 ( ) ( ) 2007-11-08 2007 ORION Project ( ) 2007-11-08 2007 -AssimilationofSSTintoaNorthwestPacificOceanCirculationModelusingEnsembleKalmanFilter( ) 2007-11-08 2007 ( ) 2007-11-08 2007 -ImplementationoftheEnsembleKalmanFiltertotheEastSeaRegionalOceanModelingSystem( ) 2007-11-08 2007 ( ) 2007-11-08 2007 -Inter-annualcomparisonoftheEastSeawithARGO dataassimilationmodelresults (ShreeRamPrakya) 2007-11-08 2007 (EFSIS) ( ) 2007-11-08 2007 -WaveletAnalysis oftheSeaLevelFluctuations associatedwithaSurgeIncidentOccurredon31thMarchalongtheWesternCoastofKorea( ) 2007-11-08 2007 -Towards anoperationalanalysis/predictionsystemusingROMS;Anexamplefortheresidualcurrents inKyunggiBay( ) 2007-11-08 2007 ?( ) 2007-11-08 2007 ( ) 2007-11-01 2007 Sandisland ( ) 2007-11-01 2007 ( ) 2007-11-01 2007 ( ) 2007-11-01 2007 - FRP ( ) 2007-11-01 2007 ( ) 2007-11-01 2007 ( ) 2007-11-01 2007 ( ) 2007-11-01 2007 ( ) 2007-11-01 2007 ( ) 2007-11-01 2007 -CO2 ( ) 2007-11-01 2007 ( ) 2007-11-01 2007 ( ) 2007-11-01 2007 ( ) 2007-11-01 2007 ( ) 2007-11-01 2007 ( ) 2007-11-01 2007 ( ) 2007-11-01 2007 Imposex ( T Horiguchi ) 2007-11-01 2007 -Two-PhaseVOF ( ) 2007-11-01 2007 -SVG WebGUI ( ) 2007-11-01 2007 -Emergyanalysis ofBangpakongEstuary Thailand(KankamnerdJariya SukMoLee) 2007-11-01 2007 -Fugongmangrove PAHs ( TianYun ) 2007-11-01 2007 ( ) 2007-11-01 2007 ( ) 2007-11-01 2007 3 ( ) 2007-11-01 2007 ( ) 2007-11-01 2007 ( ) 2007-11-01 2007 - FRP ( ) 2007-11-01 2007 ( ) 2007-11-01 2007 ( ) 2007-11-01 2007 ( ) 2007-11-01 2007 (HNS) ( ) 2007-11-01 2007 ( ) 2007-11-01 2007 -HNS( ) ( ) 2007-11-01 2007 ( ) 2007-11-01 2007 ( ) 2007-10-26 2007 ( ) 2007-10-26 2007 -2006/2007 ( ) 2007-10-26 2007 - -Square-meshwindow -( ) 2007-10-26 2007 ( ) 2007-10-26 2007 ( ) 2007-10-26 2007 ( ) 2007-10-26 2007 ( ) 2007-10-26 2007 ( ) 2007-10-26 KAIST 2007 -TheLaplacetransformationmethodforparabolicproblems ( ) 2007-10-19 -(U-Th)/Hethermochronomertyandits applications toMartianmeteorites ( ) 2007-10-17 KAIST 2007 -Yaus conjectureandLawsons conjectureonminimalsurfaces in$S^3$( ) 2007-10-05 -Changes inCrystalStructureandTermo-ElasticProperties across thePost-PerovskiteTransitionattheCore-MantleBoundary( ) 2007-09-14 KAIST 2007 -GroupSizeandBargainingPower( ) 2007-09-05 2007 -OnMeromorphicFunctions withoutJuliaDirections (PeterTien-YuChern) 2007-08-30 2007 -Maple (Shin Heesung) 2007-08-08 2007 -Rank-widthandWell-quasi-ordering( ) 2007-08-08 2007 -Thegreedyalgorithmforstrictcg-matroids ( ) 2007-08-08 2007 Maple (Kim Jangsoo) 2007-08-08 2007 -HowedualityandYoungtableaux( ) 2007-08-07 2007 -Ontheenumerationofcertainweightedgraphs ( ) 2007-08-07 2007 -OnaspectralcharacterizationoftheHamminggraphs (JackKoolen) 2007-08-07 2007 -ExcludingaBipartiteCircleGraphfromLineGraphs ( ) 2007-08-07 2007 -Onrefinements ofRamanujans partitioncongruencemodulo5http://www mathnetorkr/new_sub04/sub04_01_01php? no=3622&ko_name=%EA%B0%95%EC%88%9C%EC%9D%B4&paper_id=&key_name=%EA%B0%95%EC%88%9C%EC%9D%B4&key_locale=in(Kang Soonyi) 2007-08-07 2007 -CertainRankedposets ofLengthOneandContinuedFraction( ) 2007-08-07 2007 -Onadecompositionofsimplepolytopes (Shin Heesung) 2007-08-07 2007 -Modelingandanalyses forbiologicalnetworks ( ) 2007-08-07 2007 -Polynomialrepresentationforthenumberofpartitions withlengthfixed( ) 2007-08-07 2007 -ThresholdArrangements ( ) 2007-08-07 2007 -CircleGraphs Obstructions underPivoting( ) 2007-08-06 2007 -Countingside-pairings ofapolygonandHarer-ZagierTheorem( ) 2007-08-06 2007 -ReflexibilityofregularCayleymaps forabeliangroups http://www mathnetorkr/new_sub04/sub04_01_01php?no=3661&ko_name=%EA%B6%8C%EC%98%81%EC%88%98&paper_id=&key_name=%EA%B6%8C%EC%98%81%EC%88%98&key_locale=in(Kwon Youngsoo) 2007-08-06 2007 -Thelargestpowerof2inthenumberofinvolutions (Kim Jangsoo) 2007-08-06 KAIST -NonnegativeMatrixFactorizationandits Applications II( ) 2007-07-03 KAIST -AlgebraicK-theoryandMotivicCohomology(3)(DanGrayson) 2007-06-28 KAIST -NonnegativeMatrixFactorizationandits Applications I( ) 2007-06-28 KAIST -AlgebraicK-theoryandMotivicCohomology(2)(DanGrayson) 2007-06-27 KAIST -AlgebraicK-theoryandMotivicCohomology(1)(DanGrayson) 2007-06-27 KAIST -AdaptiveMethods forLinearDiscriminantAnalysis andKernelizedDiscriminantAnalysis ( ) 2007-06-26 KAIST -DimensionReductionforUndersampledHighDimensionalData( ) 2007-06-21 KAIST -IntroductiontoMatrixDecompositions ( ) 2007-06-19 ( ) 2007-06-01 2007 ( ) 2007-05-31 2007 : RCE ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 Emergy ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 -Diplopteneas abiomarkerfortheepiscodicmethanereleaseevents:analyticalmethodandits pilotapplication ( ) 2007-05-31 2007 -Polybrominateddiphenylethers (PBDEs inmarinesediments fromindustrializedbays ofKorea ( ) 2007-05-31 2007 -Conger-specificcharacterizaqtionandsources ofPCDD/Fs anddioxin-likePCBs inmarinesediments fromindustrialiaedbays ofKorea ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 : ( ) 2007-05-31 2007 -Temporalheterogeneityinbenthicnutrientfluxes inashallow subtidalestuaryImplications forupscaling (NiLongphuirt) 2007-05-31 2007 Cd PO4 ( ) 2007-05-31 2007 -ImpactofBreakingWaves ontheGas Transfer:Results fromLaboratoryExperiments inaLargeWind-WaveTunnelFacility ( ) 2007-05-31 2007 -EstimationofdenitrificationintheUlleungBasin:Anapplicationoflinearinversemodeling ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 -HEM-3D ( ) 2007-05-31 2007 ? ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 -SedimentsuspensioninatidalchannelofGang-whatidalflat ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 ( class ) 2007-05-31 2007 ( ) 2007-05-31 2007 OBS ( ) 2007-05-31 2007 -KONSBERG EM120S (12kHz) ( ) 2007-05-31 2007 -RTK-GPS ( ) 2007-05-31 2007 -Diatomassemblagechanges ontheBeringSeacontinentalshelfduringtheCenturies:preliminaryresults (K Katsuki) 2007-05-31 2007 -LateQuaternarypaleoceanographyinthenorthernslopeoftheBeringSeabasedonthepreliminaryresults fromradiolarianassemblage (T Itaki) 2007-05-31 2007 -Mid-PleistocenecoccolithdumpintheEastSeaforanew perspectiveofcarboncycling ( ) 2007-05-31 2007 -Types andformationconditions ofdarkmudlayers intheSouthKoreaPlateau(EastSea)duringtheLateQuaternary ( ) 2007-05-31 2007 CDM ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 -Meiofaunaextractionusingultrafinebubblegenerator ( ) 2007-05-31 2007 -Sandminingimpacts onthebenthicmacro-faunainsouthernGyeonggiBay Korea ( ) 2007-05-31 2007 -GrowthinOtolithandbodylengthofGunnels Pholis fangiintheYellow Sea ( ) 2007-05-31 2007 -Chattonellaspp ( ) 2007-05-31 2007 (microbialloop) ( ) 2007-05-31 2007 MAL-CB031 ( ) 2007-05-31 2007 -Typhoonforcedseasurfacecoolingandchlorophyll-aincreaseintheEastSeaobservedbysatelliteremotesensing (KeikoYamada) 2007-05-31 2007 -Modulationonexpressionofsex-relatedgenes byexposureofheavymetals alkylphenols oxidativestresses intheself-fertilizingfish Kryptolebias marmoratus ( ) 2007-05-31 2007 -InductionofMetallothioneingeneexpressioninheavymetal(cadmium)exposedthepufferfish Takifuguobscurus ( ) 2007-05-31 2007 Tigriopus japonicus Artemianauplii Dinophysis acuminata (DA-MAL01) ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 -AnEstimationofTyphoon-relatedOceanHeatContent(TOHC) ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 -ADCP ( ) 2007-05-31 2007 -Doublepeak-floodcurrentasymmetryinHampyungEmbaymentwithamacro-tidalflat ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 -Hydrographyandcurrentmeasurements fromHawaiitowesternPacificinsummer2006 ( ) 2007-05-31 2007 -Globaldistributionofkineticenergyfluxofnear-inertialmotionoutoftheoceanicmixedlayer:possiblemajormixingenergysource ( ) 2007-05-31 2007 -Short-termvariabilityofcurrents andits seasonalityintheKuroshioregionoftheEastChinaSea (HeeyongKim) 2007-05-31 2007 -Developmentofatongue-shapedfrontinthesouthernYellow Seaduringwinter ( ) 2007-05-31 2007 -ThermohalinefrontstructureinthesouthseaofKoreaas estimatedbyretrogressivevectordiagrammethod ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 -SeasonalVariations ofSSTintheSeas aroundKoreaandJapan ( ) 2007-05-31 2007 -EvolutionofStratificationovertheEastCoastofKorea ( ) 2007-05-31 2007 3 ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 : / ( ) 2007-05-31 2007 -Futuredirections andoceanicproxies forpaleoclimateresearch(review) ( ) 2007-05-31 2007 -CirculationandPropertyChanges intheNorthPacificOceanfortheLastGlacialMaximum ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 23 (1984-2006) ( ) 2007-05-31 2007 -Low-frequencyvariabilityofseasurfacetemperatureintheEast/JapanSea ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 (Climatechangeandoceanographicconditions inKoreaduringthepast40years) ( ) 2007-05-31 2007 CCFZ ( ) 2007-05-31 2007 ( ) 2007-05-31 2007 : / ( ) 2007-05-31 ConferenceonCom2MacAchievements inMathematics (AndreiOkounkov) 2007-05-28 ConferenceonCom2MacAchievements inMathematics 3(AndreiOkounkov) 2007-05-28 2007 KSIAM -ConvergenceofthebinomialtreemethodforPricingLookbackOptions inajump-diffusionmodel(Kwon MiJeong) 2007-05-26 2007 KSIAM -Dualitymethods fortotalvariationminimizationinimageprocessing(Chan Tony) 2007-05-26 2007 KSIAM -Data-drivenon-linecharactercontrol:PhilosophyandPromise(Shin SungYong) 2007-05-26 2007 KSIAM -Theeffects ofaxialforces toanarchsubjectingtouniformradialloads (Go Jaegwi) 2007-05-26 2007 KSIAM -Theevolutionofthestationarysolutions ofKorteweg-deVeries equationwithapositiveforcing(Whang Sungim) 2007-05-26 2007 KSIAM -ImprovementofChimeragridmethodwithmovingleastsquares method(Lee KwanJoong) 2007-05-26 2007 KSIAM -Numericalcomputationalmethodforwooddrying(Lee YongHun) 2007-05-26 2007 KSIAM -Symmetrictightwaveletframes constructedfromquasi-interpolatorysubdivisionmask(Jeong Byeongseon) 2007-05-26 2007 KSIAM -Aliasingerrorofsamplingseries inwaveletsubspaces (Kim JongMin) 2007-05-26 2007 KSIAM -A BDDCalgorithmforthreedimensionalelasticitywithmortardiscretization(Kim HyeaHyun) 2007-05-26 2007 KSIAM -Thegeneralizedinterfacedifferencemethodforellipticproblems (Lee Sunmi) 2007-05-26 2007 KSIAM -AniterativesubstructuringmethodwithLagrangemultipliers (Park Eun-Hee) 2007-05-26 2007 KSIAM -Aerodynamicshapeoptimizationusingdiscreteadjointformulationbasedonoversetmeshtechnique(Yim JinWoo) 2007-05-26 2007 KSIAM -Constructionofanon-stationarybiorthogonalwaveletsystemusingasubdivisionscheme(Jang Sumi) 2007-05-26 2007 KSIAM -Movingleastsquareapproximationusingradialbasis functions (Lee MunBae) 2007-05-26 2007 KSIAM -Redundantdecompositions andtime-frequencyanalysis (Yoon GangJoon) 2007-05-26 2007 KSIAM -Determiningthelocations anddiscontinuities inthederivatives offunct(Yoon Jungho) 2007-05-26 2007 KSIAM -Nonlinearstructuretensorusingdiffusioncoefficients basedonmage(Lee Chang-Ock) 2007-05-26 2007 KSIAM -PDE-basedimageinterpolators (Cha Youngjoon) 2007-05-26 2007 KSIAM -Levelsetbasedsimultaneous backgroundimagemodelingandegroundsegmentation(Lee Suk-Ho) 2007-05-26 2007 KSIAM -Teachingappliedmathematics forengineers-anew teachingparadigmbasedonindustrialmathematics (Taavitsainen Veli-matti) 2007-05-25 2007 KSIAM -Finesegmentationusinggeometricattraction-drivenflow andedge-regions (Hahn Jooyoung) 2007-05-25 2007 KSIAM -Optimalinvestment consumptionandretirementdecisionwithdisutilityandliquidityconstraints (Lim ByungHwa) 2007-05-25 2007 KSIAM -First-ordersystemleast-squaremethodfortheoptimalcontrol(Ryu Soorok) 2007-05-25 2007 KSIAM -Optimalerrorestimateforsemi-discreteGauge-UzawamethodfortheNavier-Stokes equations (Pyo Jae-Hong) 2007-05-25 2007 KSIAM -MutualcapacitanceviaLast-passagealgorithms (Hwang Chi-Ok) 2007-05-25 2007 KSIAM -A fractionalstepmeshfreepointcollocationmethodfortheincompressibleNavier-Stokes equations (Kim Yongsik) 2007-05-25 2007 KSIAM -A phase-fieldapproachforsurfaceareaminimizationoftriply-periodicsurfaces (Lee Hyun-Geun) 2007-05-25 2007 KSIAM -structurepredictionusingtheglobaloptimizationmethod(Lee Jinwoo) 2007-05-25 2007 KSIAM -Parallelizationandperformanceevaluationofcontact-impactsimulation(Moon JiJoong) 2007-05-25 2007 KSIAM -Micromagneticsimulations withLandau-Lipschitz-Gilbertequation(Nam WonChang) 2007-05-25 2007 KSIAM -HighperformanceDirect-iterativehybridlinearsolutionmethodforlargescalestructuralanalysis (Kim Minki) 2007-05-25 2007 KSIAM -Oversamplingexpansioninwaveletsubspaces (Park Hyun-Shik) 2007-05-25 2007 KSIAM -BoxconstrainedoptimizationforsignaldetectioninMINO channel(Park Soonchul) 2007-05-25 2007 KSIAM -Robustseismicwaveform(Ha Taeyoung) 2007-05-25 2007 KSIAM -Performanceanalysis ofpushtotalkoverIEEE80216ewithSleep/Idlemode(Baek Sangkyu) 2007-05-25 2007 KSIAM -Saturationthroughputanalysis ofIEEE80211Wireless LAN undertheRayleighfadingchannel(Cho Hong-il) 2007-05-25 2007 KSIAM -Performanceanalysis ofamodifiedSDP inunsaturatedconditionintheP-persistentIEEE80211Network(Lee ChanYong) 2007-05-25 2007 KSIAM -Existenceanduniqueness ofverysingularsolutionforthep-Laplacianequationwithconvection(Fang ZhongBo) 2007-05-25 2007 KSIAM -WeightedL^2decayfortheNavier-Stokes equations inR^2(Lee Jungho) 2007-05-25 2007 KSIAM -Multi-frequencytrans-admittancescanner(Lee Jeehyun) 2007-05-25 2007 KSIAM -AdaptivemeshrefinementfortheBlack-Scholes equations (Kim Junseok) 2007-05-25 2007 KSIAM -Tailasymptotics forthewaitingtimeinanM/G/1retrialqueue(Kim Jerim) 2007-05-25 2007 KSIAM -Queueinganalysis ofopportunisticscheduleexploitingmultiuserdiversity(Kim Yoora) 2007-05-25 2007 KSIAM -Studyofreactionratefornonidealdetonationbehaviorofaninsensitiveexplosive(Park Jeongsoo) 2007-05-25 2007 KSIAM -Bucklinganalysis ofunstiffenedcompositecylinders (Han DongYeob) 2007-05-25 2007 KSIAM -Inversekinetics androbustPID controlofa2-DOF parallelmotionsimulator(Hong Seong-Il) 2007-05-25 2007 KSIAM -CFD applications onaerodynamics designandanalysis ofvehicles (Ahn Changsoo) 2007-05-25 2007 KSIAM -A StudyonthefatiguecharacteristicofLaser-weldedsteelwithgap(Yang Haeseok) 2007-05-25 2007 KSIAM -IterativecorrectionforSPECTimagedistortedbycollimators characteristic(Lee Nam-Yong) 2007-05-25 2007 KSIAM -Real-timemotiondetectioninvideosurveillanceusingalevelset-basedenergyfunctional(Woo Hyenkyun) 2007-05-25 ConferenceonCom2MacAchievements inMathematics 2(AndreiOkounkov) 2007-05-25 ConferenceonCom2MacAchievements inMathematics 1(Hae-SooOh) 2007-05-25 ConferenceonCom2MacAchievements inMathematics 2(S K Lando) 2007-05-25 KAIST -VolatilityModelAnalysis forTimeSeries Data( ) 2007-05-23 ConferenceonCom2MacAchievements inMathematics (AndreiOkounkov) 2007-05-23 ConferenceonCom2MacAchievements inMathematics 1(AndreiOkounkov) 2007-05-23 KAIST -Randommatrices andapplications (II)( ) 2007-05-22 KAIST -Randommatrices andapplications (I)( ) 2007-05-21 2007 -2006 ( ) 2007-05-18 2007 -TheCompleteMitochondrialGenomeofeightCypriniformes species (Tanakiasignifer Carassius auratus Acheilognathus koreensis Acheilognathus imtermedia Rhodeus uyekii Rhodeus suigensis Acanthorh( ) 2007-05-18 2007 (Acheilognathus koreensis) cytochromeb ( ) 2007-05-18 2007 ( ) 2007-05-18 2007 (Iksookimiachoii) ( ) 2007-05-18 2007 Gadus macrocephalus ( ) 2007-05-18 2007 Gadus macrocephalus ( ) 2007-05-18 2007 -Theself-feritilizingfishKryptolebias marmoratus metallothioneingene:Potentialbiomarkerforheavymetalions alkylphenols andoxidativestresses (JaeSungRhee) 2007-05-18 2007 ( ) 2007-05-18 2007 Boleophtalmus pectinirostris (Linnaeus) ( ) 2007-05-18 2007 -Sexdistributionandgonaddevelopmentofpatternwithtotallengthonhagfish Eptatretus burgeriinJejucoastal(SungPyoHur) 2007-05-18 2007 (Rhynchocypris oxycephalus) ( ) 2007-05-18 2007 ( ) 2007-05-18 2007 ( ) 2007-05-18 2007 ( ) 2007-05-18 2007 4 ( ) 2007-05-18 2007 (Sebastes thompsoni) ( ) 2007-05-18 2007 -Comparativefeedingecologyoftwospecies Pseudoblennius cottoides andPseudoblennius percoides inaneelgrass (Zosteramarina)bed( ) 2007-05-18 2007 2 ( ) 2007-05-18 2007 Kichulchoiabrevifasciata(Cobitidae) ( ) 2007-05-18 2007 ( ) 2007-05-18 2007 -2006 ( ) 2007-05-18 2007 - (Horsemackerel) (TargetStrength) ( ) 2007-05-18 2007 ( ) 2007-05-18 2007 ( ) 2007-05-18 2007 Gadus macrocephalus -1 ( ) 2007-05-18 2007 (Eckloniacava) ( ) 2007-05-18 2007 (Eckloniacava) ( ) 2007-05-18 2007 Arctoscopus japonicus ( ) 2007-05-18 2007 - (Portunus trituberculatus) ( ) 2007-05-18 2007 3 (Lumpenellalongirostris) (Malacocottus gibber) (bothrocarahollandi) ( ) 2007-05-18 2007 -TwoHippolytidShrimps (Crustacea Decapoda:Caridea)fromtheDeepwateroftheEastSea Korea( ) 2007-05-18 2007 TropomodulincDNA cloning ( ) 2007-05-18 2007 -GeneticvariationandpopulationstructureofchumsalmoninferredfromthemitochondrialandmicrosatelliteDNA analyses ( ShunpeiSato SyuitiAbe) 2007-05-18 2007 ( ) 2007-05-18 2007 ( ) 2007-05-18 2007 -Reproduction survivalandproductionofPacificanchovy(Engraulis japonicus):applicationofsize-basedtheory( ) 2007-05-18 2007 -EffectofE1NinoonmigrationandlarvaltransportoftheJapaneseeel Anguillajaponica( ) 2007-05-18 2007 -SICA -( ) 2007-05-18 2007 -ManagingLivingResources onTemperateRockyReefs (DonaldR Gunders) 2007-05-18 2007 ( ) 2007-05-18 2007 -mesh-grouping ( ) 2007-05-18 2007 -Mooringloads analysis ofsubmersibleaquaculturefishcageunderirregularwaveusingfiniteelementmethod( ) 2007-05-18 2007 3 ( ) 2007-05-18 2007 -3 ( ) 2007-05-18 2007 -ECDIS AIS ARPA Radar ( ) 2007-05-18 2007 -ECDIS ( ) 2007-05-18 2007 -DEA ( ) 2007-05-18 2007 ( ) 2007-05-18 2007 ( ) 2007-05-18 2007 -2006 -( ) 2007-05-18 2007 -( ) 2007-05-18 2007 ( ) 2007-05-18 2007 ( ) 2007-05-18 2007 ( ) 2007-05-18 2007 ( ) 2007-05-18 X( ) 2007-05-18 KAIST -GeneralizedComplexGeometry( ) 2007-05-16 -OSL ( ) 2007-05-11 KAIST -Introductiontographminortheorem( ) 2007-05-03 -A NovelMechanismtoResistBacterialDiseases:QuorumQuenching( ) 2007-04-30 2007 -Embeddingtheorems andadmissiblelimits formeanLipschitzfunctions ontheunitball( ) 2007-04-21 2007 -SymmetryandnonitegrabilityofalmostCauchy-Riemannmanifolds ( ) 2007-04-21 2007 -Finitesums ofToeplitzproducts ontheDirichletspace( ) 2007-04-21 2007 -Complexsubmanifolds inrealhypersurfaces andnon-extendabilityofholomorphicfunctions ( ) 2007-04-21 2007 -VirtualBergmankernelforsomeHartogs domains ( ) 2007-04-21 2007 -Finiterankproductproblemontheupperhalf-space( ) 2007-04-21 2007 -PositiveToeplitzoperators betweenthepluriharmonicBergamanspaces ( ) 2007-04-21 2007 -Black-Scholes inaction( ) 2007-04-21 2007 -Introductiontocreditderivatives ( ) 2007-04-21 KIASWorkshoponHolomorphicSymplecticGeometry -SymplecticSingularities(3)(M Lehn) 2007-03-16 KIASWorkshoponHolomorphicSymplecticGeometry -SymplecticSingularities(4)(M Lehn) 2007-03-16 KIASWorkshoponHolomorphicSymplecticGeometry -Onsymplecticresolutions ofmodulispaces ofsheaves (J Choy) 2007-03-16 KIASWorkshoponHolomorphicSymplecticGeometry -Birationalgeometryandsymplecticvarieties (1)(Y Namikawa) 2007-03-16 KIASWorkshoponHolomorphicSymplecticGeometry -Birationalgeometryandsymplecticvarieties (2)(Y Namikawa) 2007-03-16 KIASWorkshoponHolomorphicSymplecticGeometry -Dualfibrations (J Sawon) 2007-03-15 KIASWorkshoponHolomorphicSymplecticGeometry -ClassificationofLagrangianfibrations (J Sawon) 2007-03-15 KIASWorkshoponHolomorphicSymplecticGeometry -SymplecticSingularities(1)(M Lehn) 2007-03-14 KIASWorkshoponHolomorphicSymplecticGeometry -SymplecticSingularities(2)(M Lehn) 2007-03-14 KIASWorkshoponHolomorphicSymplecticGeometry -Onsymplecticreductions ofpolarrepresentations (C Lehn) 2007-03-14 KIASWorkshoponHolomorphicSymplecticGeometry -Poissondeformations andsymplcticvarities(1)(Y Namikawa) 2007-03-14 KIASWorkshoponHolomorphicSymplecticGeometry -Poissondeformations andsymplcticvarities(2)(Y Namikawa) 2007-03-14 KIASWorkshoponHolomorphicSymplecticGeometry -Basics oncompacthyperkahlermanifolds(1)(A Fujiki) 2007-03-13 KIASWorkshoponHolomorphicSymplecticGeometry -Basics oncompacthyperkahlermanifolds(2)(A Fujiki) 2007-03-13 KIASWorkshoponHolomorphicSymplecticGeometry -Monodromies ofadegenerationofirreduciblesymplecticKahlermanifolds (YasunariNAGAI) 2007-03-13 KIASWorkshoponHolomorphicSymplecticGeometry -HolomorphicLagrangianfibrations(1)(J Sawon) 2007-03-13 KIASWorkshoponHolomorphicSymplecticGeometry -ExistenceofLagrangianfibrations (J Sawon) 2007-03-13 2007KAIST -TranscendetalNumberTheory:Lecture1http://www mathnetorkr/new_sub04/sub04_01_01php?no=4650&ko_name=Jing+Yu&paper_id=(JingYu) 2007-02-22 2007KAIST -TranscendetalNumberTheory:Lecture2http://www mathnetorkr/new_sub04/sub04_01_01php?no=4650&ko_name=Jing+Yu&paper_id=(JingYu) 2007-02-22 2007KAIST -TranscendetalNumberTheory:Lecture3http://www mathnetorkr/new_sub04/sub04_01_01php?no=4650&ko_name=Jing+Yu&paper_id=(JingYu) 2007-02-22 2007KAIST -TranscendetalNumberTheory:Lecture4http://www mathnetorkr/new_sub04/sub04_01_01php?no=4650&ko_name=Jing+Yu&paper_id=(JingYu) 2007-02-22 2007KAIST -HigherCyclotomicUnits ( ) 2007-02-01 2007KAIST -Poincaresumandtwistedcohomologyofnumberfields ( ) 2007-02-01 2007KAIST -Whatis Ramanujans answer?( ) 2007-02-01 2007KAIST -CompletelistofbinaryregularHermitianlattices overimaginaryquadraticfields ( ) 2007-02-01 2007KAIST -2007KAIST ( ) 2007-02-01 2007KAIST -Larsens conjectureontherankofabelianvarieties overcyclicfields ( ) 2007-02-01 2007KAIST -OnCongruences ofJacobiforms ( ) 2007-02-01 2007KAIST -2007KAIST ( ) 2007-02-01 2007KAIST -OntheRamanujans continuedfractionas amodularfunction( ) 2007-02-01 2007 : ( ) 2007-02-01 1-DayWorkshopfor SeismicObservationandAnalysis -Local RegionalandGlovalSeismologyandTheirApplications ( ) 2007-02-01 1-DayWorkshopfor SeismicObservationandAnalysis -1( ) 2007-02-01 1-DayWorkshopfor SeismicObservationandAnalysis -2( ) 2007-02-01 1-DayWorkshopfor SeismicObservationandAnalysis -1( ) 2007-02-01 1-DayWorkshopfor SeismicObservationandAnalysis -2( ) 2007-02-01 2007 -LevyProcesses inFinancialModelling( ) 2007-01-25 2007 -CDO Pricing( ) 2007-01-25 KAIST : ( ) 2007-01-19 KAIST -GreenFunctionEstimates forStronglyEllipticSystems ofSecondorder(SeickKim) 2007-01-04 ( ) 2006-12-08 Backtotopofpage 2006 2006 (ShigeyoshiOgawa) 2006-12-27 2006SNU-KMSWinter WorkshoponCryptography -Privacypreservingcomputation( ) 2006-12-22 2006SNU-KMSWinter WorkshoponCryptography -Groupandringsignatures ( ) 2006-12-22 2006SNU-KMSWinter WorkshoponCryptography -IntroductiontoTMTO ( ) 2006-12-22 2006SNU-KMSWinter WorkshoponCryptography ( ) 2006-12-21 2006SNU-KMSWinter WorkshoponCryptography ( ) 2006-12-21 2006SNU-KMSWinter WorkshoponCryptography MAC ( ) 2006-12-21 2006SNU-KMSWinter WorkshoponCryptography -KeygenerationforGBpollycrackercryptosystems ( ) 2006-12-21 2006SNU-KMSWinter WorkshoponCryptography -A Diffie-Hellmankeyexchangeprotocol/w/orandomoracles ( ) 2006-12-21 2006SNU-KMSWinter WorkshoponCryptography -Fairexchangeinamulti-usersetting( ) 2006-12-21 2006SNU-KMSWinter WorkshoponCryptography -Attacks onmultiplemodes ofoperationofblockciphers ( ) 2006-12-21 2006SNU-KMSWinter WorkshoponCryptography ( ) 2006-12-21 2006SNU-KMSWinter WorkshoponCryptography -SecureID-basedsignatureschemewithefficientaggregations ( ) 2006-12-21 2006SNU-KMSWinter WorkshoponCryptography -Securityof160-bitECDLP ( ) 2006-12-21 KAIST 2006 Colloquium -KernelMethodinEnumeration(Qing-HuHou) 2006-12-14 KAIST 2006 Colloquium -AutomaticalProvingofCombinatorialIdentities (Qing-HuHou) 2006-12-13 KAIST 2006 Colloquium -NumericalMethodforFinanceIhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4743&ko_name=Harry+Zheng&paper_id=(HarryZheng) 2006-12-09 KAIST 2006 Colloquium -NumericalMethodforFinanceIIhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4743&ko_name=Harry+Zheng&paper_id=(HarryZheng) 2006-12-09 KAIST 2006 Colloquium -NumericalMethodforFinanceIIIhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4743&ko_name=Harry+Zheng&paper_id=(HarryZheng) 2006-12-09 KAIST 2006 Colloquium -NumericalMethodforFinanceIV http://www mathnetorkr/new_sub04/sub04_01_01php?no=4743&ko_name=Harry+Zheng&paper_id=(HarryZheng) 2006-12-09 KAIST 2006 Colloquium (Bio-Circuitreverseengineeringtechnology( ) 2006-12-08 KSIAM2006AnnualMeeting -Concurrentmultiscalemethods forcrystallinesolids (Tang Shaoqiang) 2006-11-25 KSIAM2006AnnualMeeting -A verysingularsolutionfortheslow diffusionequationwithnonlinearconvectionterm(Fang ZhongBo) 2006-11-25 KSIAM2006AnnualMeeting -OnthelocationofcriticalpointforthePoissonequation(Kim Sun-Chul) 2006-11-25 KSIAM2006AnnualMeeting -Asymptoticanalysis ofhigh-contrastphononiccrystals andacriterionfortheband-gapopening(Lee Hyundae) 2006-11-25 KSIAM2006AnnualMeeting -Sequentialoptimalityconditions forconvexsemidefinitevectoroptimizationproblems (Lee Kwang-Baik) 2006-11-25 KSIAM2006AnnualMeeting -Correlativesparsityinsolvingoptimizationproblems (Kim Sunyoung) 2006-11-25 KSIAM2006AnnualMeeting (Kang HyungSuk) 2006-11-25 KSIAM2006AnnualMeeting -Themathematicalmodelingandnumericalsimulations forthemotionofsoapbubbles (Kang Myungjoo) 2006-11-25 KSIAM2006AnnualMeeting -Mathematicalmodelingofmultiplebubbleinteractions inhydrodynamicunstablemixing(Sohn Sung-Ik) 2006-11-25 KSIAM2006AnnualMeeting -Thecellboundaryelementmethods formultiscaleellipticproblems (Jeon Youngmok) 2006-11-25 KSIAM2006AnnualMeeting -Boundaryintegralmethodforphotoniccrystalfiber(Cho MinHyung) 2006-11-25 KSIAM2006AnnualMeeting -Algorithmforfinding90/150tridiagonalmatrices (Cho Sung-Jin) 2006-11-25 KSIAM2006AnnualMeeting -Introductionofasymmetrictightwaveletframetoimageprocessing:imagefusion imagedenoisingandimageinpainting(Choi Myungjin) 2006-11-25 KSIAM2006AnnualMeeting -Quasi-interpolatoryrefinablefuctions andconstructionofbiorthogonalwavleltsystems (Lee YeonJu) 2006-11-25 KSIAM2006AnnualMeeting -Convergenceofincreasinglyflatradialbasis interpolants topolynomialinterpolants (Yoon Jungho) 2006-11-25 KSIAM2006AnnualMeeting -IEEE80211eEDCA (Lee Dong-kyu) 2006-11-25 KSIAM2006AnnualMeeting -Analysis ofIEEE802154withnon-beaconenabledCSMA/CA bymatrixgeometricmethod(Bae YunHan) 2006-11-25 KSIAM2006AnnualMeeting -AnalyticModelofIEEE802154forbothUploadanddownloadTraffic(Kim TaeOk) 2006-11-25 KSIAM2006AnnualMeeting -FeedbackControlandStateEstimationofanHIV Model(Kwon Hee-Dae) 2006-11-25 KSIAM2006AnnualMeeting -A music-typealgorithmfordetectinginternalcorrosionfromelectrostaticboundarymeasurements (Kim Eunjoo) 2006-11-25 KSIAM2006AnnualMeeting -Topologydeteriminationofcriticalcases insurface-surfaceintersection(Oh Min-jae) 2006-11-25 KSIAM2006AnnualMeeting -Eigenvalues forthesemi-circulantpreconditioningofellipticoperators withthevariablecoefficients (Kim HoiSub) 2006-11-25 KSIAM2006AnnualMeeting -A three-levelBDDCalgorithmforMortardiscretizations (Kim HyeaHyun) 2006-11-25 KSIAM2006AnnualMeeting -Absolutelystableexplicitschemes forreactionsystems (Lee Chang-Ock) 2006-11-25 KSIAM2006AnnualMeeting -Compactlysupportedsymmetrictightwavletframes constructedfromquasi-interpolatorysubdivisionmasks (Jeong Byeongseon) 2006-11-25 KSIAM2006AnnualMeeting -B-spaces andtheircharacterizationviaanisotropicFranklinbases (Park Kyungwon) 2006-11-25 KSIAM2006AnnualMeeting -TheLinearindependenceconjecturefortimefrequencyshifts (Yoon GangJoon) 2006-11-25 KSIAM2006AnnualMeeting -AveragerateandBERexpressions forM-QAM AMCwithmultiuserdiversityoverNakagami-mfadingchannel(Kim Yoora) 2006-11-25 KSIAM2006AnnualMeeting -Cross layerdesignandanalysis ofwireless networks (Hwang GangUk) 2006-11-25 KSIAM2006AnnualMeeting -Finesegmentationusinggeometricattraction-drivenflow andedge-regions (Hahn Jooyoung) 2006-11-25 KSIAM2006AnnualMeeting -Electro-musculardisruptiondevices (Lee Jeehyun) 2006-11-25 KSIAM2006AnnualMeeting -Numericalsimulations offlows inanelasticcylinderwithtwochambers (Lee Sunmi) 2006-11-25 KSIAM2006AnnualMeeting -Normalmodeanalysis ofsecond-orderprojectionmethods forincompressibleflows (Pyo Jae-Hong) 2006-11-25 KSIAM2006AnnualMeeting -Hybriddirect-iterativelinearsolutionmethodforstructralanalysis problem(Kim Minki) 2006-11-25 CNU 2006WorkshoponNonlinear Analysis andIts Application -VolterratypeintegralequationmethodforSchrodingerequation(SheonYoungKang) 2006-11-24 CNU 2006WorkshoponNonlinear Analysis andIts Application -InverseShadowingforPartiallyHyperbolicSet(YinhaoHan) 2006-11-24 CNU 2006WorkshoponNonlinear Analysis andIts Application -Attractors fortheKlein-Gordon-Schrodingerequationwithboundaryterm(JoungaeKim) 2006-11-24 CNU 2006WorkshoponNonlinear Analysis andIts Application -Onthestabilityofsinefunctionalequation(GwangHuiKim) 2006-11-24 CNU 2006WorkshoponNonlinear Analysis andIts Application -Thestabilityofgeneralizedpolynomial(GP)functions ofdegree2(Yang-HiLee) 2006-11-24 CNU 2006WorkshoponNonlinear Analysis andIts Application -Various shadowingproperties inLorenzattractor(TaeyoungChoi) 2006-11-24 CNU 2006WorkshoponNonlinear Analysis andIts Application -Stabilityforthefunctionalequationofcubictype(Ick-SoonChang) 2006-11-24 KSIAM2006AnnualMeeting -Generalizedfunctiontheoryandits applications (Yu YungHoon) 2006-11-24 KSIAM2006AnnualMeeting -Stock-pricemodels andoptionpricing(Chung DongMyung) 2006-11-24 KSIAM2006AnnualMeeting -A numericalmethodforthequaternaryCahn-Hilliardsystem(Kim Junseok) 2006-11-24 KSIAM2006AnnualMeeting -Flow fieldcomputationbyupwindmeshfreemethodforsimplifiedhighvoltagegas circuitbreakermodel(Park Seong-Kwan) 2006-11-24 KSIAM2006AnnualMeeting -ConvergenceaccelerationoftheEulerequationthroughsparsepointrepresentation(Lee Dohyung) 2006-11-24 KSIAM2006AnnualMeeting -CACTUS CFD toolkit:combinationofaerodynamicsolverwithadvancedcomputingtechnologies (Ko Soon-Heum) 2006-11-24 KSIAM2006AnnualMeeting -Applicationofdifferentialalgebraicequationsolvers tohelicopterflightdynamicanalysis (Kim ChangJoo) 2006-11-24 KSIAM2006AnnualMeeting -Acousticdiffractionfromafiniteplate(Jeon Wonju) 2006-11-24 KSIAM2006AnnualMeeting -Closed-formupperbounds fortheoptimalexerciseboundaryofAmericanput(Byun Suk-Joon) 2006-11-24 KSIAM2006AnnualMeeting -A studyofvaluationofbonus options inwith-profitinsuranceproducts basedonassetsharemodel(Han Sangil) 2006-11-24 KSIAM2006AnnualMeeting -Analysis oftheseveralnumericalschemes forthethinfilmequations (Ha Youngsoo) 2006-11-24 KSIAM2006AnnualMeeting -Collocationmeshfreemethods as aflow solver;whatwearedonewithandwhatwearedoingnow (Kim DoWan) 2006-11-24 KSIAM2006AnnualMeeting -Developmentofrepetitiveresponsesurfaceenhancementforthemultidisciplinaryoptimazation(Jeon Kwon-Su) 2006-11-24 KSIAM2006AnnualMeeting -E-airs:anaerospaceresearchportalserviceonthee-sciencetechnology(Ahn JaeWan) 2006-11-24 KSIAM2006AnnualMeeting -UsingMATLABtopriceandanalyseoption(Owen Don) 2006-11-24 KSIAM2006AnnualMeeting -Ontheuseofrealizedquasi-MonteCarlomethodinEuropeanoptionpricing(Jeon Doobae) 2006-11-24 KSIAM2006AnnualMeeting -First-ordersystemleast-squares mixedfiniteelementmethods usingRaviart-Thomas space(Shin Byeong-Chun) 2006-11-24 KSIAM2006AnnualMeeting -Error-analysis ofone-dimensionalHelmholtzequationwithPMLboundary(Ha Taeyoung) 2006-11-24 KSIAM2006AnnualMeeting -Grid-basedautomatics 3D meshgenerationfromtheplanatcross-sections (Ahn Soyoung) 2006-11-24 2006 ( ) 2006-11-23 2006 -( ) 2006-11-23 2006 ( ) 2006-11-23 2006 SS ( ) 2006-11-23 2006 ( ) 2006-11-23 2006 ( ) 2006-11-23 2006 ( ) 2006-11-23 2006 (Lw) (bidirectionalfactor) ( ) 2006-11-23 2006 DNA ( ) 2006-11-23 2006 ( ) 2006-11-23 2006 ( ) 2006-11-23 2006 Chattonellaovata ( ) 2006-11-23 2006 ( ) 2006-11-23 2006 ( ) 2006-11-23 2006 ( ) 2006-11-23 2006 3 ( ) 2006-11-23 2006 ( ) 2006-11-23 2006 ( ) 2006-11-23 2006 PFCs ( ) 2006-11-23 2006 ( ) 2006-11-23 2006 ( ) 2006-11-23 2006 ( ) 2006-11-23 2006 ( ) 2006-11-23 2006 CO2 ( ) 2006-11-23 2006 -CO2 ( ) 2006-11-23 2006 -FRP ( ) 2006-11-23 2006 -2 ( ) 2006-11-23 2006 ( ) 2006-11-23 2006 ( ) 2006-11-23 2006 ( ) 2006-11-23 2006 ( ) 2006-11-23 2006 ( ) 2006-11-23 2006 ( ) 2006-11-23 2006 - Ewiniar(2006) ( ) 2006-11-23 2006 WADEM ( ) 2006-11-23 2006 -FUNWAVE ( ) 2006-11-23 2006 -TRIVAST 3 ( ) 2006-11-23 2006 ( ) 2006-11-23 2006 ( ) 2006-11-23 2006 ( ) 2006-11-23 2006 ( ) 2006-11-23 2006 Network ( ) 2006-11-23 -Effects NaturalOrganicMatter(NOM)onCuSorptionatthecalcite-waterInterface-SystematicUptakeStudies andEXAFS SperctroscopyAnalysis ( ) 2006-11-23 KAIST 2006 Colloquium -CopulaMethods inFinanceI( ) 2006-11-17 KAIST 2006 Colloquium -CopulaMethods inFinanceII( ) 2006-11-17 2006 ( ) 2006-11-16 2006 (JinHoLee HyunSooKim YoungBokKim SeongRyolYang KyungHoShon) 2006-11-16 2006 -DevelopmentofNonlinearControlAlgorithmforAutomaticBerthingofShips (MoonCheolWon SeongKukHong YunHaJung SunYoungKim NamSunSon HyunGyuYoon) 2006-11-16 2006 -CPMC (YoungShikKim BongHuanJun JongSuChoi JinHaKim SeokWonHong) 2006-11-16 2006 (SungJinMa BongHuanJun PanMookLee SangBongKim) 2006-11-16 2006 (AUV) (BongHuanJun JinYeongPark PanMookLee FillYoubLee JongMooLee JunHoOh) 2006-11-16 2006 -UnscentedKalmanFilter Simultaneous LocalizationandMapping (AromHwang WooJaeSeong) 2006-11-16 2006 ( ) 2006-11-16 2006 ( ) 2006-11-16 2006 3 ( ) 2006-11-16 2006 ( ) 2006-11-16 2006 HIL ( ) 2006-11-16 2006 ( ) 2006-11-16 2006 -MFCC ( ) 2006-11-16 2006 ( ) 2006-11-16 2006 ( ) 2006-11-16 2006 ( ) 2006-11-16 2006 ( ) 2006-11-16 2006 ( ) 2006-11-16 2006 ( ) 2006-11-16 2006 ( ) 2006-11-16 2006 ( ) 2006-11-16 2006 ( ) 2006-11-16 2006 ( ) 2006-11-16 2006 ( ) 2006-11-16 2006 ( ) 2006-11-16 2006 ( ) 2006-11-16 2006 Spectrum ( ) 2006-11-16 2006 -MGIS 3 ( ) 2006-11-16 2006 -TidalcurrentpowergenerationbyaDarrieus typewaterturbineatthesideofabridgePier (YusakuKyozuka HisanoriWakahama) 2006-11-16 2006 -Recentdevelopments ofwaveenergyutilizationinDenmark (J P Kofoed P Frigaard M Kramer) 2006-11-16 2006 -Wave-currentinteractions inMarineCurrentTurbines (N Barltrop A Grant K S Varyani D Clelland X P Pham) 2006-11-16 2006 -How muchpowercanbeobtainedfromthetides? (Chris Garrett) 2006-11-16 2006 -Tidaldynamics andtidalcurrentpowergenerationintheUldolmokWaterway (SokKuhKang Ki-DaiYum KwangSooLee JinSoonPark) 2006-11-16 KAIST 2006 Colloquium -NumericalModelingandSimulationof12and3Components FluidFlows ( ) 2006-11-10 KAIST 2006 Colloquium -Earth Universe CategoryandMirrorSymmetry(WeiDongRuan) 2006-11-09 -IssueinNuclearWaste:YuccaMountainandNevadaTestSite(Prof FranklinW Schwartz) 2006-11-06 2006 - McMurdo polycyclicaromatichydrocarbons (PAHs) ( ) 2006-11-02 2006 -DistributionofPersistentOrganicPollutants inSediments fromtheOceanDumpingSites intheYellow Sea( ) 2006-11-02 2006 -Butyltins inenvironmentalsamples fromtheBusanharbour Korea( ) 2006-11-02 2006 -RapidDevelopments andPersistentOrganicContaminants ( ) 2006-11-02 2006 -Polybrominateddiphenylethers (PBDEs)insedimentandbivalves fromKoreancoastalwaters ( ) 2006-11-02 2006 nonylphenol ( ) 2006-11-02 2006 -PersistentOrganicPollutants inSediments andBivalves intheEastCoastofChina( ) 2006-11-02 2006 : ( ) 2006-11-02 2006 -TracingHydrothermalVentPlumebyDissolvedMethaneAnalysis UsingHeadSpaceandGas Chromatography-SemiconductiveDetector( ) 2006-11-02 2006 -Properties oftheEastSeaIntermediateWaterRevealedbyIsopycnalAnalysis ( ) 2006-11-02 2006 -2005 ( ) 2006-11-02 2006 -2006 ( ) 2006-11-02 2006 -Sedimentresuspensionprocess intheSaemangeumregion(GuanHongLee) 2006-11-02 2006 -Seasonalvariations ofnortherncoastalbeachsediments intheJejuIsland Korea(JeungSuYoun YongSeungPark) 2006-11-02 2006 ( ) 2006-11-02 2006 :areview ( ) 2006-11-02 2006 -LocalPaleoceanographicSynchronicityintheKoreaPlateau EastSeaduringthelateQuaternary( ) 2006-11-02 2006 -GlacialseasurfacetemperatureintheEastSea( ) 2006-11-02 2006 Myrionectarubra (1) ( ) 2006-11-02 2006 -Seasonalvariationofdiatoms intheAsanBay(QuangdungBach YongSikSin SungRyullYang ChulPark) 2006-11-02 2006 -Cochlodiniumpolykrikoides ( ) 2006-11-02 2006 Alteromonas sp A14 Cochlodiniumpolykrikoides ( ToshiyaKatano ) 2006-11-02 2006 -GrowthandsurvivalofDinophysis acuminataas functions ofpreyconcentrationandlightintensity( ) 2006-11-02 2006 Dinophysis acuminata ( ) 2006-11-02 2006 -DistributionoftheheterotrophicdinoflagellatePfieteriapiscicidainKoreanwaters andits feedingonmixotrophicdinoflagellates raphidophytes andfishbloodcells ( ) 2006-11-02 2006 -Ultrastructureandphylogeneticanalysis ofpreviouslyunclassifiedheterotrophicflagellatePleurostomumflabellatum(Ruinen1938) anextremehalophilewithintheHeterolobosea( ) 2006-11-02 2006 -LongtermvariationanddistributioncharacteristicofphytoplanktonintheKyeonngiBay(HyuChangChoi YoungSeukPark JoongKiChoi) 2006-11-02 2006 -TrophicimportanceofalgalcarbontomacroinvertebrateproductioninanintertidalsaltmarshScirpus triqueterecosystem( ) 2006-11-02 2006 -DiversifiedOrganicMatterSources FuelingtheCommonReed(Phragmites australis)BedFoodWebintheNakdongRiverEstuary( ) 2006-11-02 2006 : ( ) 2006-11-02 2006 ( ) 2006-11-02 2006 ( ) 2006-11-02 2006 Sr/Caratios (Chelonhaematocheilus) (Synechogobius hasta) (migratorytype)( ) 2006-11-02 2006 -Fishendocrineimpactanalysis basedonGeneralizedLinearModel(GLM)-acasestudyinMasanBay( ) 2006-11-02 2006 -Geneticseparationofchumsalmon(Oncorhynchus keta)collectedfromthewesternBeringSeaduringsummer-autumn2004( ) 2006-11-02 2006 -Spatio-temporaldistributionofPacificanchovy Engraulis japonicus eggs offtheWestCoastofKorea( ) 2006-11-02 2006 -MeteorogicalandOceanographicEnvironments AffectedbyTypoonSongdaneartheEasternCoastofKorea( ) 2006-11-02 2006 -CoastalWindInfluencedbyWindStormovertheMountain( ) 2006-11-02 2006 -Tidalcurrentcharacteristics onthewesterntipofthesouthwestcoastofKorea( ) 2006-11-02 2006 ( ) 2006-11-02 2006 ( ) 2006-11-02 2006 ( ) 2006-11-02 2006 ( ) 2006-11-02 2006 -FVCOM-derivedH/U3mapandits comparisonwithtidal-frontlocations intheSetoInlandSea japan(YounJongSun AtsuhikoIsobe) 2006-11-02 2006 ( ) 2006-11-02 2006 ( ) 2006-11-02 2006 -EastChinaSearesponsetothetyphoonEwiniar2006( ) 2006-11-02 2006 - - ( ) 2006-11-02 2006 ( ) 2006-11-02 2006 -TidalFrontintheYellow Sea-FocusedontheSouthwesternAreaonAugust 2005(KiRyongKang) 2006-11-02 2006 -OriginofColdBias overtheequatorialPacificandits impactonENSO simulationinacoupledGCM (JongSeongKug InSikKang) 2006-11-02 2006 3 ( ) 2006-11-02 2006 -A NumericalStudyontheSeasonalWaterCirculationintheSetoInlandSea Japan(Pil-HunChang) 2006-11-02 2006 -VariabilityofMesoscaleEddies inthePacificOceanSimulatedbyanEddyResolvingOGCM of1/12˚( ) 2006-11-02 2006 LES( ) ( ) 2006-11-02 2006 :( )( ) 2006-11-02 2006 - ( ) 2008 ( ) 2006-11-02 2006 - - ( ) 2006-11-02 2006 ( ) 2006-11-02 2006 ( ) 2006-11-02 2006 -2006 ( ) 2006-11-02 2006 ( ) 2006-11-02 2006 -Long-termBottomPressureMeasurementnearDokdo( ) 2006-11-02 2006 -OnthepenetrationofKuroshioWaterontotheEastChinaSeashelf( ) 2006-11-02 2006 -GIS ( ) 2006-11-02 2006 -Behavioroflow salinitywatermass aroundtheNorthernEastChinaSeain2006(InSeongHan KiTackSeong YoungSangSuh WonDeukYoon LeeHyunJang HoKyunKim JiHyunLee) 2006-11-02 2006 ( ) 2006-11-02 2006 -Turbulentenergydissipationrateintheseas adjacenttoKorea(JaeHakLee SungTaeJang ChangSooHong ChangJooJang HongSikMin) 2006-11-02 2006 ( ) 2006-11-02 2006 ( ) 2006-11-02 2006 ( ) 2006-11-02 2006 ( ) 2006-11-02 2006 ( ) 2006-11-02 GlobalKMSDay -Applicationofnumbertheoryandalgebraicgeometrtocryptography(KarlRubin) 2006-10-28 GlobalKMSDay -Crystalbases ofquantumgroups (MasakiKashiwara) 2006-10-28 GlobalKMSDay -OnRepresentationTheoryofQuadraticForms-focusedonUniversalForms (Myung-HwanKim) 2006-10-28 GlobalKMSDay -Refinedclass numberformulaandits generalization(JoongulLee) 2006-10-28 GlobalKMSDay -NormalCM-fields (Soun-HiKwon) 2006-10-28 GlobalKMSDay -AutomorphismGroups ofAlgebraicSurfaces (JongHaeKeum) 2006-10-28 GlobalKMSDay -Onnon-singularstarflows (LanWen) 2006-10-28 GlobalKMSDay -Characteristicclasses inthecobordismtheoryofsingularmaps (Andras Szucs) 2006-10-28 GlobalKMSDay -GeneralizedMaximumPrinciples andTheirApplications toS S CHERNs conjecture(YoungJinSuh) 2006-10-28 GlobalKMSDay -ParametricFloertheoryandspectralinvariants (Yong-GeunOh) 2006-10-28 GlobalKMSDay -Onsomeinvariantsubspaces ofoperators (IlBongJung) 2006-10-28 GlobalKMSDay -Denseness ofnorm-attainingmappings (YunSungChoi) 2006-10-28 GlobalKMSDay -GeometryandGeometricMeans (RajendraBhatia) 2006-10-28 GlobalKMSDay -ComputationofGalois groups andsplittingfields ofpolynomials (KazuhiroYokoyama) 2006-10-28 GlobalKMSDay -Tatepairingcomputation(Hyang-SookLee) 2006-10-28 GlobalKMSDay -OnRisk-senstivedynamicportfoliooptimization(JunSekine) 2006-10-28 GlobalKMSDay -Someopenproblems ininfinitedimensionalalgebras (EfimZelmanov) 2006-10-27 GlobalKMSDay -Recentdevelopmentoftheminimalmodeltheory(YujiroKawamata) 2006-10-27 GlobalKMSDay -HalphenPencils onFano3-foldWeightedHypersurfaces http://www mathnetorkr/new_sub04/sub04_01_01php?no=3735&ko_name=%EB%B0%95%EC%A7%80%ED%9B%88&paper_id=&key_name=%EB%B0%95%EC%A7%80%ED%9B%88&key_locale=in(Park Jihun) 2006-10-27 GlobalKMSDay -A combinatorialproofofaWeyl-typeformulaforhookSchurpolynomials (Jae-HoonKwon) 2006-10-27 GlobalKMSDay -Polynomialrings (ByungGyunKang) 2006-10-27 GlobalKMSDay -CanonicalForms forComplexMatrixCongruenceandCongruence(RogerHorn) 2006-10-27 GlobalKMSDay -Comtrans algebrarepresentation(BokheeIm) 2006-10-27 GlobalKMSDay -Criticalexponents anduniformgrowthofgroups innegativecurvature(GerardBesson) 2006-10-27 GlobalKMSDay -CriterionforconvergenceofKleiniangroups-SolutiontoThurstons conjecture(InkangKim) 2006-10-27 GlobalKMSDay -Geometryof$R^3\times R$(KyungBaiLee) 2006-10-27 GlobalKMSDay -ThecanonicalRiemanniansubmersionofacompactLieGroup(JeongHyeongPark) 2006-10-27 GlobalKMSDay -Noncommutativetoriandtheirmirros (HoilKim) 2006-10-27 GlobalKMSDay -Contactstructures andopendecompositions (Jin-HongKim) 2006-10-27 GlobalKMSDay -SpecialGeometries withtorsioninstringtheory(Thomas Friedrich) 2006-10-27 GlobalKMSDay -Extensionproblemincomputertopology(Sang-EonHan) 2006-10-27 GlobalKMSDay -OnsemirelativisticHartreeequations (TohruOzawa) 2006-10-27 GlobalKMSDay -SingularityinNavier-Stokes Flow (HiJunChoe) 2006-10-27 GlobalKMSDay -Closedgeodesics onspheres (YimingLong) 2006-10-27 GlobalKMSDay -Schroeigerflow nearharmonicmaps (KyungkeunKang) 2006-10-27 GlobalKMSDay -ExistenceofFourSolutions oftheNonlinearHamiltonianSystemwithNonlinearityccrossingtwoEigenvalues (TackSunJung) 2006-10-27 GlobalKMSDay -LeonhardEuler(1707-1783)andtheComputationalAspects ofSomeZeta-FunctionSeries (HariSrivastava) 2006-10-27 GlobalKMSDay -SomeApplications ofGammaandPolygammafunctions (JunesangChoi) 2006-10-27 GlobalKMSDay -OptimalLinearCodes over$Z_n$(StevenS Dougherty) 2006-10-27 GlobalKMSDay -RecentIssues inOptionPriing(InJoonKim) 2006-10-27 GlobalKMSDay -A DomainDecompositionMultiscaleMixedMethodforFlow inPorous Media(MaryF Wheeleer) 2006-10-27 GlobalKMSDay -ConductivityImagingUsingInjectedCurrentNonlinearEncoding(ICNE)methodinMREIT(OnInKwon) 2006-10-27 GlobalKMSDay -LevelSetBasedSimulations ofTwo-PhaseOil-WaterFlows inPipes (MyungjooKang) 2006-10-27 GlobalKMSDay -RandomGraphs RandomRegularGraphs andCouplings (JeongHanKim) 2006-10-27 GlobalKMSDay -Asymptotics for$L^p$-valuedGaussianrandomfields (Yong-KabChoi) 2006-10-27 2006 ( ) 2006-10-27 2006 - - ( ) 2006-10-27 2006 - ( ) 2006-10-27 2006 2 ( ) 2006-10-27 2006 3 ( ) 2006-10-27 2006 ( ) 2006-10-27 2006 - ( ) 2006-10-27 2006 (Portunus trituberculatus) ( ) 2006-10-27 2006 - - ( ) 2006-10-27 2006 ( ) 2006-10-27 2006 ( ) 2006-10-27 KAIST 2006 Colloquium -Thecellboundaryelementmethod( ) 2006-10-20 KAIST 2006 Colloquium -Poissoncloningmodelandgiantcomponentofrandomgraphs (Kim JeongHan) 2006-09-29 KAIST 2006 Colloquium -FiniteGroups andK3surfaces ( ) 2006-09-27 -MetamorphismintheHeartofEasternGondwana(Dr SajeevKrishnan) 2006-09-26 -Designerpowdercrystallographyofzeolites atsynchrotronsources ( ) 2006-09-15 -Anotherwaytolookintotheearth-Seismicimagingfromscatteredwavefields ( ) 2006-09-08 2006InternationalWorkshoponDynamicalSystems andRelatedTopics -Analysis ofdeterministicsystems (KyewonKohPark) 2006-08-03 2006InternationalWorkshoponDynamicalSystems andRelatedTopics -A strongclosinglemmainnonuniformhyperbolicity(WenxiangSun) 2006-08-03 2006InternationalWorkshoponDynamicalSystems andRelatedTopics -Absolutelycontinuous invariantmeasures forexpansivediffeomorphisms ofthe2-torus (NaoyaSumi) 2006-08-03 2006InternationalWorkshoponDynamicalSystems andRelatedTopics -Onseparationproperties andthetopologicalpressure(KenichiroYamamoto) 2006-08-03 2006InternationalWorkshoponDynamicalSystems andRelatedTopics -A joiningcharacterizationoffactors ofsimplemaps (Young-HoAhn) 2006-08-03 2006InternationalWorkshoponDynamicalSystems andRelatedTopics -ContinuityofSRBmeasureandentropyfornonuniformlyeapanding1D maps (YongZhang) 2006-08-03 2006InternationalWorkshoponDynamicalSystems andRelatedTopics -OptimalcontrolofdampedKlein-Gordonequations withstateconstraints (JongYeoulPark) 2006-08-03 2006InternationalWorkshoponDynamicalSystems andRelatedTopics -$C^1$stableshadowingdiffeomorphisms (KazuhiroSakai) 2006-08-03 2006InternationalWorkshoponDynamicalSystems andRelatedTopics -Onthezetafunctionofan$S$-gapshift(Young-OneKim) 2006-08-03 2006InternationalWorkshoponDynamicalSystems andRelatedTopics -Localdimensionofinvariantmeasureforintervalmaps (YongMooChung) 2006-08-03 2006InternationalWorkshoponDynamicalSystems andRelatedTopics -Someproperties ofset-valueddynamicalsystems (HahngYunChu) 2006-08-03 2006InternationalWorkshoponDynamicalSystems andRelatedTopics -Necessaryconditions for$C^1$-stabilityofdifferentiablemaps (KazumineMoriyasu) 2006-08-03 2006InternationalWorkshoponDynamicalSystems andRelatedTopics -Structuralstabilityofvectorfields withvarious shadowing(KeonheeLee) 2006-08-03 The5thKAIST GeometricTopologyFair -Quivers andthehomologyofnilpotentgroups (KentE Orr) 2006-08-02 The5thKAIST GeometricTopologyFair -Knottheory:Modernmethods inlow dimensions (KentE Orr) 2006-08-02 The5thKAIST GeometricTopologyFair -Somegeometricproblems ofphysicalknots I(KentE Orr) 2006-08-02 The5thKAIST GeometricTopologyFair -Somegeometricproblems ofphysicalknots I(YuananDiao) 2006-08-02 The5thKAIST GeometricTopologyFair -Somegeometricproblems ofphysicalknots II(YuananDiao) 2006-08-02 The5thKAIST GeometricTopologyFair -Embeddingtheory:highdimensions throughexamples (KentE Orr) 2006-07-31 The5thKAIST GeometricTopologyFair -Topologicalandgeometricalproblems ofrandomknots (YuananDiao) 2006-07-31 2006 -Stochasticcalculus duetoKiyoshiItoandsubsequentdevelopments (YujiIto) 2006-07-27 2006 -Ergodictheoryconnectedwithinfinitemeasurepreservingtransformations (YujiIto) 2006-07-25 2006 -Essentials ofStochasticProcesses IX (YujiIto) 2006-07-21 2006 -Essentials ofStochasticProcesses VIII(YujiIto) 2006-07-20 2006 -Essentials ofStochasticProcesses VII(YujiIto) 2006-07-19 2006 -Essentials ofStochasticProcesses VI(YujiIto) 2006-07-12 2006 -Essentials ofStochasticProcesses V (YujiIto) 2006-07-11 2006 -Essentials ofStochasticProcesses IV (YujiIto) 2006-07-10 2006 -Essentials ofStochasticProcesses III(YujiIto) 2006-07-07 2006 -Essentials ofStochasticProcesses II(YujiIto) 2006-07-06 2006 -Essentials ofStochasticProcesses I(YujiIto) 2006-07-05 KAIST 2006 Colloquium -Modularforms fornoncongruencesubgroups (WinnieLi) 2006-06-29 2006 -RecentTopics andAdvancedMethods inEconomics andMathematicalFinanceIV ( ) 2006-06-28 2006 -RecentTopics andAdvancedMethods inEconomics andMathematicalFinanceII( ) 2006-06-27 2006 -RecentTopics andAdvancedMethods inEconomics andMathematicalFinanceIII( ) 2006-06-27 2006 -RecentTopics andAdvancedMethods inEconomics andMathematicalFinanceI( ) 2006-06-26 2006KIAS-KMSWorkshoponCryptography -CombinatorialStudyofAlgebro-geometricObjects viaMonomialIdelas ( ) 2006-06-24 2006KIAS-KMSWorkshoponCryptography -Algebraiccryptanalysis usingGrobnerbasis ( ) 2006-06-24 2006KIAS-KMSWorkshoponCryptography ( ) 2006-06-24 2006KIAS-KMSWorkshoponCryptography -Pairing ( ) 2006-06-24 2006KIAS-KMSWorkshoponCryptography -Pairing ( ) 2006-06-24 2006KIAS-KMSWorkshoponCryptography ( ) 2006-06-23 2006KIAS-KMSWorkshoponCryptography -TheThreeThemes inQuantumMechanics ( ) 2006-06-23 KNU InternationalconferenceonHigh-order NumericalMethods for solvingPDEs -Laminarflow pastasimplifiedviralcapsidstructuremodel(Kim DoWan) 2006-05-27 KNU InternationalconferenceonHigh-order NumericalMethods for solvingPDEs -Thecellboundaryelementmethods (Jeon Youngmok) 2006-05-27 KNU InternationalconferenceonHigh-order NumericalMethods for solvingPDEs -SolvingHyperbolicpartialdifferentialequations insphericalgeometrywithradialbasis functions (Flyer Natash) 2006-05-27 KNU InternationalconferenceonHigh-order NumericalMethods for solvingPDEs -AlgorithmforPhotomaskmachine(Kim Hoisub) 2006-05-26 KNU InternationalconferenceonHigh-order NumericalMethods for solvingPDEs -Finiteelementmethods fordealingwithpoissonproblemwithdiscontinuous coefficients (Kim SeokChan) 2006-05-26 KNU InternationalconferenceonHigh-order NumericalMethods for solvingPDEs -GaugeUzawamethods forIncompressibleflows withVariableDensityflows (Pyo Jae-Hong) 2006-05-26 KNU InternationalconferenceonHigh-order NumericalMethods for solvingPDEs -Operatorsplittingforhigh-orderadaptivemeshrefinementonthesphere(St-Cyr Amik) 2006-05-26 KNU InternationalconferenceonHigh-order NumericalMethods for solvingPDEs -Radialbasis functions -Somerecentdevelopments (Fornberg Bengt) 2006-05-26 KNU InternationalconferenceonHigh-order NumericalMethods for solvingPDEs -Piecewisebilinearpreconditioningonhigh-order(Kim SangDong) 2006-05-26 KNU InternationalconferenceonHigh-order NumericalMethods for solvingPDEs -Automaticinitialmeshgenerationbyagrid-basedtemplate(Ahn Soyoung) 2006-05-26 KNU InternationalconferenceonHigh-order NumericalMethods for solvingPDEs -Pseudospectralmethods-afinitedifferenceintroductiontotheperiodiccase(I)(Fornberg Bengt) 2006-05-26 KNU InternationalconferenceonHigh-order NumericalMethods for solvingPDEs -FromclassicaltooptimizedSchwarz(PartIII)(St-Cyr Amik) 2006-05-26 KAIST 2006 Colloquium -FiniteGroups andK3surfaces ( ) 2006-05-26 -Up-andDown-ScalingofEvapotranspirationMaps Derives fromLandsatandMODIS Images -A ( ) 2006-05-26 -Up-andDown-ScalingofEvapotranspirationMaps Derives fromLandsatandMODIS Images -B( ) 2006-05-26 2006 (Gadus macrocephalus) ( ) 2006-05-19 2006 -ComplementaryInvertigationonFishCommunitywithDifferentSamplingGears (JunwonSeo) 2006-05-19 2006 -2005 (EEZ) ( ) 2006-05-19 2006 -MigrationandspawningofriverlampreyLampetrafluviatilis inrelationtospawninghabitatavailabilityinaregulatedriverRiverDerwent (MIN-HO JANG andMARTYNC LUCAS) 2006-05-19 2006 Liobagrus mediadiposalis 2type ( ) 2006-05-19 2006 Kichulchoiabrevifasciata ( ) 2006-05-19 2006 -Acanthorhodeus (CyprinidaeAcheilognathinae) ( ) 2006-05-19 2006 ( ) 2006-05-19 2006 Iksookimiakoreensis(Cobitidae) ( ) 2006-05-19 2006 (Plecoglossus altivelis) ( ) 2006-05-19 2006 ( ) 2006-05-19 2006 ( ) 2006-05-19 2006 ( ) 2006-05-19 2006 Boleophthalmus pectinirostris Mechanism ( ) 2006-05-19 2006 -Structureoftheskinofaslendercatfish Silurus microdorsalis (SiluridaePisces) (Jong-YoungParkandHyun-A Baek) 2006-05-19 2006 Pleuronectes obscurus (Herzenstein) Konosirus punctatus (TemmincketSchlegel) Pseudoblennius percoides(Gunther) ( ) 2006-05-19 2006 (Tetraodontiformes) ( ) 2006-05-19 2006 (genus Zacco) ( ) 2006-05-19 2006 (Paralichthyidae) 1 ( ) 2006-05-19 2006 -MoleculardiversityofMaurolicus japonicus fromoffKoreanPeninsula (SungKIM Choong-GonKIM JuunaOH Hyun-SeokSEO DageumJEONG Youn-HoLeeWoong-SeoKim) 2006-05-19 2006 3 ( ) 2006-05-19 2006 3 ( ) 2006-05-19 2006 ( ) 2006-05-19 2006 ( ) 2006-05-19 2006 -InhibitionofbacterialphospholipasebymethoxylatedfattyacidisolatedfromthebrownseaweedIshigeokamurae (ChoJY GyawaliYP AhnSH KhanMNA KongIs andHongYK ) 2006-05-19 2006 DNA ( ) 2006-05-19 2006 -GrowthoflarvalPacificAnchovy Engraulis japonicus intheYellow Seaas indicatedbyotolithmicrostructureanalysis (S -D Hwang M -H Song T-W Lee G A McFarlaneAND J R King) 2006-05-19 2006 ( ) 2006-05-19 2006 ( ) 2006-05-19 2006 -VariabilityingrowthandsurvivalofKoreanchumsalmoninrelationtoclimatechanges duringthe1980s-1990s (HyunjuSeoSuamKim SukyungKangKibeikSeong) 2006-05-19 2006 -GeneticVariations andDifferences ofChumSalmon(Oncorhynchus keta)alongtheNorth-PacificRealm (MinHoKang JungYoungPark SuamKim) 2006-05-19 2006 NEMURO ( ) 2006-05-19 2006 ( ) 2006-05-19 2006 ( ) 2006-05-19 2006 ( ) 2006-05-19 2006 -MULTIFAN-CL ? (Thynnys maccoyii) ( ) 2006-05-19 2006 -The conotoxins andneuronalacetylchlinereceptors(nAChRs) (HyunWooKim) 2006-05-19 2006 ( ) 2006-05-19 2006 ( ) 2006-05-19 2006 -CpmparisonofvitellogeninresponseinRockfishinducedbyPCB153and4-Nonylphenol ( ) 2006-05-19 2006 Ruditapes philippinarum Glutathione ( ) 2006-05-19 2006 GIS -MDM(MarineDigitizedMap) 3 -( ) 2006-05-15 2006 ( ) 2006-05-15 2006 - FRP ( ) 2006-05-15 2006 - FRP (Rovingcloth) ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 1) ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 1) ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 (1)- ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 -Nano-S 2 ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 -2005 ( ) 2006-05-15 2006 -2005 ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 -2005 ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 -Dielvariations inDMSP andDMS ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 -Depthranges ofalkenoneproductionintheEastSea ( ) 2006-05-15 2006 -MovingShip CO2 ( ) 2006-05-15 2006 AVS SEM ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 -Globalrelationships oftotalalkalinitywithsalinityandtemperatureinsurfacewaters ofthemajoroceans (LanT Tong) 2006-05-15 2006 -Seismicreflectionpatterns oftheKoreaStraitshelfmudoffthesoutheasterncoastofKoreaandtheHolocenerelativesea-levelchange ( ) 2006-05-15 2006 -Paleoceanographicdiscordancebycomplexsedimentationinthebathymetric-highs theEastSea( ) 2006-05-15 2006 Mg/Ca ( ) 2006-05-15 2006 -IODP 310TahitiSealevelChange ( ) 2006-05-15 2006 -SedimentTransportinAdjacent butDistinctiveEstuaries ofSouthwestFlorida( ) 2006-05-15 2006 ( ) 2006-05-15 2006 -Theadvantages ofcoralskeletalisotopecompositions forpaleoclimatereconstructions (M Shimamura) 2006-05-15 2006 -Paleo-TsushimaWaterinfluxandits effectonsurfacewaterconditions intheEastSeaduringthelastglacialmaximum:Revisited( ) 2006-05-15 2006 ( ) 2006-05-15 2006 -HolocenetolatePleistoceneplanktonicforaminiferafromtheouter-shelfsediments oftheKoreaStrait( ) 2006-05-15 2006 -SimulationofSurfaceTemperatureandHydrologicalBudgetChangefortheLastGlacialMaximum( ) 2006-05-15 2006 5 ( ) 2006-05-15 2006 18O Mg/Ca 4 ( ) 2006-05-15 2006 -Anoverview onpaleoclimateandpaleoceanographicchanges byEastAsiamonsoonevolutioninKorea( ) 2006-05-15 2006 ( ) 2006-05-15 2006 -Satelliteobservationofspringbloomingvariationinfluencedbywindstress intheEastSea( ) 2006-05-15 2006 -Factors controllingthegrowthofsummerphytoplanktoninthesoutheasternBeringSea( ) 2006-05-15 2006 ( ) 2006-05-15 2006 Myrionectarubra ( ) 2006-05-15 2006 -Analysis ofHistoricalrecords ofHarmfulAlgalBlooms (HABs)fortheSouthYellow SeaandtheEastChinaSea (DanLingTang) 2006-05-15 2006 -PhysicalOceanicconditions onsummertimerelatedwithHarmfulAlgalBlooms intheKoreanWaters ( ) 2006-05-15 2006 -Bacterivorybyco-occurringred-tidealgae heterotrophicnanoflagellates andciliates onmarinebacteria( ) 2006-05-15 2006 ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 (N-tox)( ) 2006-05-15 2006 ( ) 2006-05-15 2006 PCBs ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 -Heatshockproteins fromtheintertidalcopepodTigriopus japonicus as apossiblebiomarkerforenvironmentalstresses ( ) 2006-05-15 2006 -Antioxidantdefencegenes (ascorbateperoxidaseandglutathionereductase)fromtheintertidalcopepodTigriopus japonicus as apossiblebiomarkerforenvironmentaloxidativechemicals ( ) 2006-05-15 2006 -Expression purificationandcharacterizationofglutathioneS-transferaseinthehermaphroditicfishRivulus marmoratus (Cyprinodontiformes Rivulidae)( ) 2006-05-15 2006 -ModulationoftwodistinctcytochromeP450aromatasebyendocrinedisruptingchemicals inthehermaphroditicfishRivulus marmoratus ( ) 2006-05-15 2006 -HepaticCYP1A levels andEROD activityinMarbledsole-acasestudyinMasanBay( ) 2006-05-15 2006 -DNA ( ) 2006-05-15 2006 -FunctionalGenomicApproaches forSoftCoralCommunityHealthAssessment( ) 2006-05-15 2006 -JavaneseMedaka Oryzias javanicus aNew TestOrganismforAquaticRiskAssessment( ) 2006-05-15 2006 -Influences ofcycloniceddyOpalactivityonmicrobialcommunitydynamics intheleeofHawaii (EJ Yang) 2006-05-15 2006 -DifferingMarineEcologicalRegimes OverA Meso-ScaleDistanceInTheSouthwestAtlanticSectorOfSouthernOcean;ResponseToSeaIceRetreatOrEddies?( ) 2006-05-15 2006 ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 ; decoupling ( ) 2006-05-15 2006 -RegionalOperationalOceanographicSystemfortheYellow SeaandtheEstablishmentofGOOS ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 -OnthelocationfortheJointKorea-ChinaYellow SeaBuoy( ) 2006-05-15 2006 -TidalRegimeChangeoftheYellow andEastChinaSeas duetotheSaemankeumtidalbarrierandSiwhatidalpowerplantoperation( ) 2006-05-15 2006 -OceanicturbulencewithinthebottomboundarylayerintheEastChinaSea( ) 2006-05-15 2006 ( ) 2006-05-15 2006 -ENSO amplitudechanges inclimatechangecommitmenttoatmosphericCO2doubling( ) 2006-05-15 2006 -GenerationoftheclimatologicaltemperatureandsalinityintheEastAsianMarginalSeas ona1/4° grid( ) 2006-05-15 2006 3 ( ) 2006-05-15 2006 -TurbulentFlow Characteristics intheDoboySound GeorgiaUSA:AnObservationandModelSimulation(KiRyongKang) 2006-05-15 2006 -Comparisonofmixedandmixinglayerdepths simulatedbyanOGCM ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 -TheRoleandEffectofSSTontheTyphoonIntensity(KiRyongKang) 2006-05-15 2006 ( ) 2006-05-15 2006 -UnderstandingoftheEastSeaCirculationbyusingAltimeter ArgoandSST( ) 2006-05-15 2006 ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 (MT) ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 ( ) 2006-05-15 2006 (Stone-weir ) ( ) 2006-05-15 2006 -100 ( ) 2006-05-15 KAIST 2006 Colloquium -AsymptoticProperties forIncrements ofL∞-valuedGaussianRandom( ) 2006-05-12 -Advances inGeodynamics fromMulti-AltitudeGeophysicalObservations ( ) 2006-04-28 -Frontiers inRockMagnetism-PartA :SpinelinMartianMeteoriteSau008:Implications forMartianMagentism( ) 2006-04-07 -Frontiers inRockMagnetism-PartB:VariationofAncientGeomagneticFieldIntensity( ) 2006-04-07 2006KIASSchoolonComplexAnalysis -Interpolationproblems inseveralcomplexvariables (DrorVarolin) 2006-03-30 2006KIASSchoolonComplexAnalysis -Bergmankernelfunctions fornonhomogeneous domains (JongdoPark) 2006-03-30 2006KIASSchoolonComplexAnalysis -d-barclosedextensions offorms fromarealhypersurfaceinC^n(JaeseoChoi) 2006-03-30 2006KIASSchoolonComplexAnalysis -L^2-methods inseveralcomplexvariables:3 Bergmankernels andholomorphicMorseinequalities (BoBerndtsson) 2006-03-29 2006KIASSchoolonComplexAnalysis -L^2-methods inseveralcomplexvariables:4 Curvatureofdirectimages (BoBerndtsson) 2006-03-29 2006KIASSchoolonComplexAnalysis -L^2-methods inseveralcomplexvariables:1 BasictechniqueofHoermander-typeL^2-estimates ford-bar TheKodairavanishingtheorem(BoBerndtsson) 2006-03-28 2006KIASSchoolonComplexAnalysis -L^2-methods inseveralcomplexvariables:2 TheOhsawa-Takegoshiextensiontheorem(BoBerndtsson) 2006-03-28 2006KIASSchoolonComplexAnalysis -Non-subellipticestimates forthetangentialCauchy-Riemannsystem(HeungjuAhn) 2006-03-28 2006KIASSchoolonComplexAnalysis -Non-isotropicweightedL^pestimates forthed-barequationonpiecewisesmoothstrictlypseudoconvexdomains (HongRaeCho) 2006-03-28 2006KIASSchoolonComplexAnalysis -Microlocalmethods ind-barestimates (AndreeaNicoara) 2006-03-28 -SeismicinvestigationofEarth`s small-scalestructure( ) 2006-03-28 -TerraSAROceanography(Dr SusanneLehner) 2006-03-24 2006TOPOLOGY SEMINAR -IntroductiontoMechanincs 5( ) 2006-03-10 2006TOPOLOGY SEMINAR -IntroductiontoMechanincs 4( ) 2006-03-03 2006TOPOLOGY SEMINAR -IntroductiontoMechanincs 3( ) 2006-02-24 2006TOPOLOGY SEMINAR -IntroductiontoMechanincs 2( ) 2006-02-17 2006TOPOLOGY SEMINAR -IntroductiontoMechanincs 1( ) 2006-02-10 2006TOPOLOGY -Cohomologyoffacerings andtorus actions 3http://www mathnetorkr/new_sub04/sub04_01_01php?no=4425&ko_name=Taras+PANOV&paper_id=(Taras panov) 2006-02-08 2006TOPOLOGY -Cohomologyoffacerings andtorus actions 4http://www mathnetorkr/new_sub04/sub04_01_01php?no=4425&ko_name=Taras+PANOV&paper_id=(Taras panov) 2006-02-08 2006TOPOLOGY -Cohomologyoffacerings andtorus actions Ihttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4425&ko_name=Taras+PANOV&paper_id=(Taras panov) 2006-02-03 2006TOPOLOGY -Cohomologyoffacerings andtorus actions 2http://www mathnetorkr/new_sub04/sub04_01_01php?no=4425&ko_name=Taras+PANOV&paper_id=(Taras panov) 2006-02-03 2006TOPOLOGY -Automorphismgroups ofToricmanifolds http://www mathnetorkr/new_sub04/sub04_01_01php?no=4424&ko_name=Mikiya+Masuda&paper_id=(MikiyaMasuda) 2006-02-03 2006WorkshoponProjectiveAlgebraicGeometry -Nodalhypersurfaces inP^4andCayley-Bacharachconjecturehttp://www mathnetorkr/new_sub04/sub04_01_01php? no=3735&ko_name=%EB%B0%95%EC%A7%80%ED%9B%88&paper_id=&key_name=%EB%B0%95%EC%A7%80%ED%9B%88&key_locale=in(ParkJihun) 2006-01-25 2006WorkshoponProjectiveAlgebraicGeometry -Multisecantlinetoprojectivevarietyandhypersurfaces containgprojectivevarietyhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4384&ko_name=Atsushi+Noma&paper_id(AtsushiNoma) 2006-01-25 2006WorkshoponProjectiveAlgebraicGeometry -Computationalmethods inphylogeneticalgebraicgeometryandconstructingphylogenetictreeusingflattenings (YoungRockKim) 2006-01-24 2006WorkshoponProjectiveAlgebraicGeometry -GeometryofAlgebraicFunctions (MakotoNamba) 2006-01-23 2006WorkshoponProjectiveAlgebraicGeometry -Normalgenerationoflinebundles onamultiplecoveringcurve(SeonjaKim) 2006-01-23 2006WorkshoponProjectiveAlgebraicGeometry -Syzygies:Geometry Combinatorics andComplexityI II andIII(SorinPopescu) 2006-01-23 2006WorkshoponProjectiveAlgebraicGeometry -Syzygies ofhigherorderVeroneseembeddingofprojectivevarieties http://www mathnetorkr/new_sub04/sub04_01_01php? no=3952&ko_name=%EB%B0%95%EC%9D%98%EC%84%B1&paper_id=&key_name=%EB%B0%95%EC%9D%98%EC%84%B1&key_locale=in(Park Euisung) 2006-01-23 2006WorkshoponProjectiveAlgebraicGeometry -Castelnuovotheoryandtopologyofalgebraicvarieties (FyodorZak) 2006-01-23 KoreaMathematicalMethods for Curves andSurfaces Dongseo2006 -CopyrightProtectionofDigitalImage(Sung-HoBae) 2006-01-10 NIMSWinter SchoolonAlgebraicgeometry -Onspecialdivisors oncurves InvitedSpeakers (GerrietMartens) 2006-01-10 NIMSWinter SchoolonAlgebraicgeometry -Planemodels ofdoublecovers ofsmoothcurves (DongsooShin) 2006-01-10 -VelocityStatistics inferredfromTOPEX/JASON TandemAltimeterData-A (Prof DetlefStammer) 2006-01-10 -VelocityStatistics inferredfromTOPEX/JASON TandemAltimeterData-B(Prof DetlefStammer) 2006-01-10 NIMSWinter SchoolonAlgebraicgeometry -Deformations ofcomplexmanifolds andholomorphicmaps (MarcoManetti) 2006-01-09 NIMSWinter SchoolonAlgebraicgeometry -Modulispaceofcurves (GavrilFarkas) 2006-01-08 NIMSWinter SchoolonAlgebraicgeometry -Stabilitycomputationofalgebraicvarieties (DonghoonHyeon) 2006-01-08 2006The1stInternationalWorkshoponMathematicalScience -Nonlineardistributionalgeometry(MichaelKunzinger) 2006-01-06 2006The1stInternationalWorkshoponMathematicalScience -Weaksolutionconcepts forsomekineticequations (RolandSteinbauer) 2006-01-06 2006The1stInternationalWorkshoponMathematicalScience -Spikelayersolutions forsingularlyperturbednonlinearellipticproblems (JaeyoungByeon) 2006-01-06 2006The1stInternationalWorkshoponMathematicalScience -OnstabilityoftheplaneCouetteflow (HyunseokKim) 2006-01-06 2006The1stInternationalWorkshoponMathematicalScience -Multipleexistenceofsolutions forsemilinearellipticproblem(WanSeKim) 2006-01-06 2006The1stInternationalWorkshoponMathematicalScience -PressureRepresentationandBoundaryRegularityoftheNavier-Stokes Equations withSlipBoundaryCondition(Hyeong-OhkBae) 2006-01-06 2006The1stInternationalWorkshoponMathematicalScience -p-Laplacianandits inverseproblemonnonlinearnetworks (Jong-hoKim) 2006-01-06 2006The1stInternationalWorkshoponMathematicalScience -Bochner-MartinelliintegralandLayerPotentialinthecomplexunitball(JaesungLee) 2006-01-06 2006The1stInternationalWorkshoponMathematicalScience -A fastmethodforsolvingtheinversemediumprobleminelectricalresistancetomographyandinmagneticinductiontomography(AntonelloTamburrino) 2006-01-06 2006The1stInternationalWorkshoponMathematicalScience -Someremarks onLorentzx-rayproblemintheframeoftherotatedaxes (TakashiTakiguchi) 2006-01-06 2006The1stInternationalWorkshoponMathematicalScience -Recentdevelopmentofheatkernelmethodinthetheoryofgeneralizedfunctions (KunioYoshino) 2006-01-06 2006The1stInternationalWorkshoponMathematicalScience -Onaclass ofPexiderizedfunctionalequations indistributions (JaeyoungChung) 2006-01-06 2006The1stInternationalWorkshoponMathematicalScience -Methodofnonuniformsamplingtheoremhttp://www mathnetorkr/new_sub04/sub04_01_01php? no=883&ko_name=%EC%8B%A0%EC%B0%BD%EC%96%B8&paper_id=&key_pos=%EC%84%9C%EA%B0%95%EB%8C%80%ED%95%99%EA%B5%90&key_locale=in(ChangEonShin) 2006-01-06 2006The1stInternationalWorkshoponMathematicalScience -Inversesourceproblems onnetworks (NamKeeLee) 2006-01-06 2006The1stInternationalWorkshoponMathematicalScience -Onaninversesourceproblemfortheheatequation(Yun-SungChung) 2006-01-06 2006The1stInternationalWorkshoponMathematicalScience -Conductivityandcurrentdensityimaginginmagneticresonanceelectricalimpedancetomography(Oh-InKwon) 2006-01-00 2006 -q-BernoulliNumbers andPolynomials AssociatedwithMultipleq-ZetaFunctions andBasicL-series (Kim Taekyun) 2006-01-00 2006 -OnGross conjectureandits refinement(Aoki Noboru) 2006-01-00 2006 -RefinedGrosss conjecture(Lee Joongul) 2006-01-00 2006 -Onmod3Galois representations withconductor4(Moon Hyunsuk) 2006-01-00 2006 -Tetragonalmodularcurves (Jeon Daeyeol) 2006-01-00 2006 -ModuliofGalois representations II--Finiteness conjectures http://www mathnetorkr/new_sub04/sub04_01_01php?no=4562&ko_name=Yuichiro+Taguchi&paper_id=(Taguchi Yuichiro) 2006-01-00 2006 -Punctureddistributions ofglobalfunctionfields (Bae Sunghan) 2006-01-00 2006 -Ellipticcurves withlargeTate-Shafarevichgroups (Matsuno Kazuo) 2006-01-00 2006 -Circulardistributions andaresultofSolomon(Seo Soogil) 2006-01-00 2006 -OntheevenK-groups ofalgebraicintegers ofcyclotomicfields (Aoki Miho) 2006-01-00 2006 -Iwasawainvariants andcongruenceofmodularforms (Byeon Dongho) 2006-01-00 2006 -Oncertainrealabelianfields with$\lamnda_2=\mu_2=\nu_2=0$(Taya HisaoandYamamoto Gen) 2006-01-00 2006 -p-adicL-functions forGalois deformationspaces andIwasawamainConjecture(Ochiai Tadashi) 2006-01-00 2006 -Ontheproperties of*-polytopenumbers (Kim HyunKwang) 2006-01-00 2006 -A potentialanalogueofSchinzelhypothesis forpolynomials withcoefficients inF_q[t](Bender Andreas) 2006-01-00 2006 -Twistedtraces andsingularvalues (Kim ChangHeon) 2006-01-00 2006 -Onpowerintegralbases ofthe2-elementaryabelianextensionfields (Nakahara ToruandPark Kyungho) 2006-01-00 2006 -Equivalentcontinuedfractions andtheBauer-Muirtransformation(Sohn Jaebum) 2006-01-00 2006 -Finiteness ofabelianfundamentalgroups withrestrictedramification(Hiranouchi Toshiro) 2006-01-00 KoreaMathematicalMethods for Curves andSurfaces Dongseo2006 -Subdivision:fromStationarytoNon-stationaryscheme(Jung-hoYoon) 2006-01-00 KoreaMathematicalMethods for Curves andSurfaces Dongseo2006 -Nonuniformandlocalvariationalsubdivision(ScottN Kersey) 2006-01-00 KoreaMathematicalMethods for Curves andSurfaces Dongseo2006 -Bivariateorthogonalpolynomials ontriangulardomains (AbedallahRababah) 2006-01-00 KoreaMathematicalMethods for Curves andSurfaces Dongseo2006 -FastMultipoleMethodforGlobalIllumination(SharatChandran) 2006-01-00 KoreaMathematicalMethods for Curves andSurfaces Dongseo2006 -SubdivisionZoo(KwanPyoKo) 2006-01-00 KoreaMathematicalMethods for Curves andSurfaces Dongseo2006 -IntroductiontoLiftingScheme(YooHoon) 2006-01-00 KoreaMathematicalMethods for Curves andSurfaces Dongseo2006 -Wavelets (SangsuPark) 2006-01-00 KoreaMathematicalMethods for Curves andSurfaces Dongseo2006 -MagicSquares (Jae-chilYoo) 2006-01-00 KoreaMathematicalMethods for Curves andSurfaces Dongseo2006 -B-splines snakealgorithm(ChangHoKim) 2006-01-00 KoreaMathematicalMethods for Curves andSurfaces Dongseo2006 -CardinalE-splines (MunbaeLee) 2006-01-00 KoreaMathematicalMethods for Curves andSurfaces Dongseo2006 -SVD andits application(JoonJaeLee) 2006-01-00 KoreaMathematicalMethods for Curves andSurfaces Dongseo2006 -LocalizationforMobileRobotUsingMonocularVision(HyunsikAhn) 2006-01-00 KoreaMathematicalMethods for Curves andSurfaces Dongseo2006 -ShortestPathAdmistDiscObstacles (Sung-WooChoi) 2006-01-00 KoreaMathematicalMethods for Curves andSurfaces Dongseo2006 -SplineMethods inCAGD (Byung-GookLee) 2006-01-00 Pusan-KyushuSymposium onPartialDifferentialEquations -Decaystructureofrefularity-loss typeandapplicationtosomehyperbolic-ellipticsystem(ShuichiKawashima) 2006-01-00 Pusan-KyushuSymposium onPartialDifferentialEquations -BilinearboundaryoptimalcontrolofthevelocityterminaKirchhoffplateequation(JongYeoulPark) 2006-01-00 Pusan-KyushuSymposium onPartialDifferentialEquations -Recurrentdimensions ofquasi-periodicattractors forsecondordernonlinearevolutionequations withmultipleperiodicterms (KoichiroNaito) 2006-01-00 Pusan-KyushuSymposium onPartialDifferentialEquations -Weaksolutions tosomefluiddynamics equations (TakayukiKobayashi) 2006-01-00 Pusan-KyushuSymposium onPartialDifferentialEquations -GlobalexistenceanduniformdecayforthecoupledKlein-Gordon-Schrodingerequations withnonlinearboundarydampingandmemoryterm(JoungAeKim) 2006-01-00 Pusan-KyushuSymposium onPartialDifferentialEquations -Globalattractors fornonlinearwaveequations withnonlineardissipativeterms (MitsuhiroNakao) 2006-01-00 Pusan-KyushuSymposium onPartialDifferentialEquations -Controllabilityforpartialneutralfunctionalstochasticintegrodifferentialequations withunboundeddelay(P Balasubramaniam) 2006-01-00 Pusan-KyushuSymposium onPartialDifferentialEquations -Remarks onthescatteringtheoryfornonlinearSchrodingerequations withStarkpotential(YoshihisaNakamura) 2006-01-00 Pusan-KyushuSymposium onPartialDifferentialEquations -Introductiontononlinearmatrixequations (Hyun-MinKim) 2006-01-00 Pusan-KyushuSymposium onPartialDifferentialEquations -Onasymptoticbehaviorofsolutions ofthecompressibleNavier-Stokes equationinaninfinitelayer(YoshiyukiKagei) 2006-01-00 Pusan-KyushuSymposium onPartialDifferentialEquations -Instabilityofvortexsolitons for2D focusingNLS (TetsuMizumachi) 2006-01-00 Pusan-KyushuSymposium onPartialDifferentialEquations -Energydecayforthenonlinearwaveequationwithahalf-lineardissipationinRN (YongHanKang) 2006-01-00 Pusan-KyushuSymposium onPartialDifferentialEquations -Uniformdecayforthenonlinearplateequationwithboundaryconditions ofmemorytype(HaengJooLee) 2006-01-00 Pusan-KyushuSymposium onPartialDifferentialEquations -Uniformdecayforahyperbolicsystemwithdifferentialinclusionandnonlinearmemorysourcetermontheboundary(SunHyePark) 2006-01-00 Pusan-KyushuSymposium onPartialDifferentialEquations -UniformdecayfortheKirchhoffplateequations withnonlineardissipation(JumRanKang) 2006-01-00 Pusan-KyushuSymposium onPartialDifferentialEquations -Controllabilityforthesecondorderdifferentialequations withnonlocalcondition(YoungChelKwun) 2006-01-00 Pusan-KyushuSymposium onPartialDifferentialEquations -WeakandstrongconvergenceoftheIshikawaiterationprocess witheroors fortwoasymptoticallynonexpansivemappings (JaeUgJeong) 2006-01-00 -Planets Mars andEarth:Evolutionofvolatiles ;whatmeteorites tellus abouthistories ofplanetaryobjects?(Prof KurtMarti) 2005-05-02 Backtotopofpage 2005 2009 ( ) 2009-11-05 KAIST VideoArchives 2005 -Someaspects ofclassicalalgebraicgeometry(FyodorZak) 2005-12-28 2005 KSIAMAnnualMeeting -Climatemodeling:A challengeformathematicians (GeorgeR Sell) 2005-11-25 KAIST VideoArchives 2005 -UsefulDerivatives ( ) 2005-11-25 -Molecular-scalecharacterizationofmetalsorptionmechanisms inEnvironmentalBiogeochemistry-A ( ) 2005-11-18 -Molecular-scalecharacterizationofmetalsorptionmechanisms inEnvironmentalBiogeochemistry-B( ) 2005-11-18 2005 -IMO/MEPC53 ( ) 2005-11-17 2005 ( ) 2005-11-17 2005 ( ) 2005-11-17 2005 ( ) 2005-11-17 2005 ( ) 2005-11-17 2005 ( ) 2005-11-17 2005 - FRP ( ) 2005-11-17 2005 -CO2 ( ) 2005-11-17 2005 -CO2 ( ) 2005-11-17 2005 -CO2 ( ) 2005-11-17 2005 ( ) 2005-11-17 2005 - ( ) 2005-11-17 2005 ( ) 2005-11-17 2005 ( ) 2005-11-17 2005 ( ) 2005-11-17 2005 ( ) 2005-11-17 2005 Chattonella ( ) 2005-11-17 2005 ( ) 2005-11-17 2005 ( ) 2005-11-17 2005 ( ) 2005-11-17 2005 ( ) 2005-11-17 2005 ( ) 2005-11-17 2005 ( ) 2005-11-17 2005 ( ) 2005-11-17 2005 -( ) 2005-11-17 2005 ( ) 2005-11-17 2005 ( ) 2005-11-17 2005 ( ) 2005-11-17 2005 Cochlodiniumpolykrikoides ( ) 2005-11-17 2005 / -( ) 2005-11-17 2005 ( ) 2005-11-17 2005 PFOS PFCs ( ) 2005-11-17 2005 ( ) 2005-11-17 2005 -IdentificationforInsulinSignalKinetics inHEK293Cells viaMathematicalModeling( ) 2005-11-10 -A ( ) 2005-11-10 -B( ) 2005-11-10 2005 -Compactificationofmoduliofabelianvarieties 3 level3andlevel4cases indimensionone(IkuNakamura) 2005-11-09 2005 -Compactificationofmoduliofabelianvarieties 4 aSQAS ofdimension8associatedwithE8(IkuNakamura) 2005-11-09 2005 -Compactificationofthemoduliofabelianvarieties 1 anoverview (IkuNakamura) 2005-11-08 2005 -Compactificationofmoduliofabelianvarieties 2 Faltings-Chaidegenerationdataandstability(IkuNakamura) 2005-11-08 -IODP ( ) 2005-11-02 -ODP Leg204-Drillinggas hydrateatHydrateRidge( ) 2005-11-02 2005 -Class fieldtheoryofalgebraicvarieties overfinitefields (WayneRaskind) 2005-10-28 2005 -Globalclass fieldtheoryofarithmeticschemes (WayneRaskind) 2005-10-28 2005 -Motivationforclass filedtheoryReview ofclassicallocalandglobal(abelian)class fieldtheory(WayneRaskind) 2005-10-27 2005 -Higherdimensionallocalclass fieldtheoryandclass fieldtheoryofvarieties overlocalfields (WayneRaskind) 2005-10-27 2005 ( ) 2005-10-27 2005 ( ) 2005-10-27 2005 ( ) 2005-10-27 2005 / ( ) 2005-10-27 2005 ( ) 2005-10-27 2005 ( ) 2005-10-27 2005 ( ) 2005-10-27 2005 ( ) 2005-10-27 2005 - ( ) 2005-10-27 2005 ( ) 2005-10-27 2005 ( ) 2005-10-27 2005 ( ) 2005-10-27 2005 (SS) ( ) 2005-10-27 2005 ( ) 2005-10-21 2005 ( ) 2005-10-21 2005 ( ) 2005-10-21 2005 ( ) 2005-10-21 2005 ( ) 2005-10-21 KAIST VideoArchives 2005 -Threebasicresults forrealanalyticproperG-manifolds (SorenIllman) 2005-09-20 KAIST VideoArchives 2005 -Hilberts 5thproblemandproperactions ofliegroups (SorenIllman) 2005-09-15 POSTECH XIV ( ) 2005-08-12 POSTECH XIII( ) 2005-08-10 POSTECH XII( ) 2005-08-08 POSTECH XI( ) 2005-08-05 POSTECH X ( ) 2005-08-04 POSTECH IX ( ) 2005-08-03 POSTECH VIII( ) 2005-07-29 POSTECH VI() 2005-07-28 POSTECH VIII( ) 2005-07-27 POSTECH V () 2005-07-26 POSTECH VII( ) 2005-07-25 POSTECH VI( ) 2005-07-22 2005 -Estimates forfouriercoefficients ofSiegelcuspforms (WKohnen) 2005-07-22 2005 -Oninfiniteq-productexpansions ofmodularfunctions (WKohnen) 2005-07-21 2005 -OnthefirstsignchangeofHeckeeigenvalues ofnewforms (WKohnen) 2005-07-21 POSTECH V ( ) 2005-07-20 POSTECH IV () 2005-07-20 POSTECH III() 2005-07-19 POSTECH IV ( ) 2005-07-18 POSTECH III( ) 2005-07-15 POSTECH II() 2005-07-14 POSTECH II( ) 2005-07-13 POSTECH I() 2005-07-12 POSTECH I( ) 2005-07-11 2005KSIAMConferenceinSpring -Euler-Bernoullibeamwithdynamicfrictionless contact(Ahn Jeongho) 2005-05-21 2005KSIAMConferenceinSpring -FEM onNonlinearFreeSurfaceFlow (Bai KwangJune) 2005-05-21 2005KSIAMConferenceinSpring -ExpansiveWavelet-basedApproaches ForSatelliteImageFusion(Choi Myungjin) 2005-05-21 2005KSIAMConferenceinSpring -FEM-BEM couplingforelectro-magneticproblems inR3(E P Stephan) 2005-05-21 2005KSIAMConferenceinSpring -OxygenDeliveryThroughCapillaries (Go Jaegwi) 2005-05-21 2005KSIAMConferenceinSpring -EfficientValue-at-RiskestimationforMortgageBackedSecurities (Han Chulwoo) 2005-05-21 2005KSIAMConferenceinSpring -A SimpleApproachforStochasticInterestRateOptionPricingModel(Hyun Jung-Soon) 2005-05-21 2005KSIAMConferenceinSpring -StabilizationfortheNonlineardampedWaveEquations inExteriorDomains (Jung IlHyo) 2005-05-21 2005KSIAMConferenceinSpring -A bifurcationphenomenonfromthebottomofcontinuous spectrum(Kim Chan-gyun) 2005-05-21 2005KSIAMConferenceinSpring -Multi-dimensionallimitingprocess forhyperbolicconservationlaws (Kim Chongam) 2005-05-21 2005KSIAMConferenceinSpring -Discontinuous meshfreeapproximation(Kim DoWan) 2005-05-21 2005KSIAMConferenceinSpring -A posteriorierrorestimators forP1nonconformingapproximationofquasi-NewtonianStokes flows (Kim Kwang-Yeon) 2005-05-21 2005KSIAMConferenceinSpring -ButterworthFilters Scalingfunctions andFrameWavelets (Kim RaeYoung) 2005-05-21 2005KSIAMConferenceinSpring -Thefiniteelementmethoddealingwithcornersingularities:Div-Curlsystem(Kim Seokchan) 2005-05-21 2005KSIAMConferenceinSpring -Longtimeasymptotics andapotentialcomparisontechnique(Kim YongJung) 2005-05-21 2005KSIAMConferenceinSpring -Two-channelSamplinginWaveletSubspaces (Lee Eunghyun) 2005-05-21 2005KSIAMConferenceinSpring -A MathematicalModellingofSignalTransductionSystemviaInsulin(Lim Kyung-Kuk) 2005-05-21 2005KSIAMConferenceinSpring -Identificationoforiginofnumericalscatterincrashsimulationinparallelcomputingenvironment(Paik Seung-Hoon) 2005-05-21 2005KSIAMConferenceinSpring -DesignofparallelblockLanczos codebasedondatastructureofmultifrontalsolver(Park SiHyong) 2005-05-21 2005KSIAMConferenceinSpring -SolvingMatrixPolynomialbyNewtons Method(Seo JongHyeon) 2005-05-21 2005KSIAMConferenceinSpring -Computationalmodelingofwavepropagations incompositesaturatedporoviscoelasticmedia(Sheen Dongwoo) 2005-05-21 2005KSIAMConferenceinSpring -Eigenvalueproblemforasingularone-dimensionalp-Laplacianandits applications (Sim Inbo) 2005-05-21 2005KSIAMConferenceinSpring -Thermodynamicallyself-consistentmodelforamaterialthatundergoes solid-liquid-gas phasetransitions withchemicalreaction(Yoh Jai-ick) 2005-05-21 The7-thInternationalWorkshoponDifferentialEquations -Self-similarisothermalirrotationalmotionfortheEuler Euler-Poissonsystems andtheformationoftheplasmasheathhttp://www mathnetorkr/new_sub04/sub04_01_01php?no=4317&ko_name=Marshall+Slemrod&paper_id=(Marshall Slemrod) 2005-05-21 The7-thInternationalWorkshoponDifferentialEquations -New LyapunovfunctionalandL1-stabilityoftheVlasov-Poissonsystem(Seung-YealHa) 2005-05-21 The7-thInternationalWorkshoponDifferentialEquations -OntheaxisymmetricBoussinesqequations (JihoonLee) 2005-05-21 2005KSIAMConferenceinSpring -Space-TimeDiscretizationofHyperbolicEquations (DanieleFunaro) 2005-05-20 2005KSIAMConferenceinSpring -Aboutfullypolynomialapproximabilityofthegeneralizedknapsackproblem(Hong Sung-Pil) 2005-05-20 2005KSIAMConferenceinSpring -LevelSetMethods andImageProcessing(Kang Myungjoo) 2005-05-20 2005KSIAMConferenceinSpring -OnDenoisingMethods basedonEdge-PreservingSmoothingFilters (Kim Dai-Gyoung) 2005-05-20 2005KSIAMConferenceinSpring -Exactdynamicstiffness matrixofnon-symmetricthin-walledcurvedbeams (Kim Moon-Young) 2005-05-20 2005KSIAMConferenceinSpring -TowardImplementationofSemidefintieProgramRelaxations forPolynomialOptimizationProblems (Kim Sunyoung) 2005-05-20 2005KSIAMConferenceinSpring -Segmentationandbackgroundextractionwithapplicationtoe-catalogue(Lee Chang-Ock) 2005-05-20 2005KSIAMConferenceinSpring -Various regularizationfunctions insystemidentificationproblems forsolids (Lee Jeeho) 2005-05-20 2005KSIAMConferenceinSpring -Return-mappingalgorithmforcyclicloadinganalysis ofdamagedstructures (Lee HaeSung) 2005-05-20 2005KSIAMConferenceinSpring -Networkdisconnectionproblems inacentralizednetwork(Myung Young-Soo) 2005-05-20 2005KSIAMConferenceinSpring -Evaluationofrobustperformanceoffuzzysupervisorycontroltechnique(Park Kwan-Soon) 2005-05-20 2005KSIAMConferenceinSpring -Robuststructuralcontroldesignusinggeneralizedsemi-infinitemin-maxoptimization(Park Wonsuk) 2005-05-20 2005KSIAMConferenceinSpring -Waveforminversionusinglogarithmicwavefield(Shin Changsoo) 2005-05-20 2005KSIAMConferenceinSpring -Co-evolutionaryapproaches fornumericaloptimization(Tahk MinJae) 2005-05-20 2005KSIAMConferenceinSpring -OptimalControlTheoryAppliedtoaDifferenceEquationModelofCardiopulmonaryResuscitationwithChestCompressionOnly(Jung Eunok) 2005-05-20 2005KSIAMConferenceinSpring -Constraint-PreservingNumericalMethods forHyperbolicPartialDifferentialEquations (ManuelTorrilhon) 2005-05-20 The7-thInternationalWorkshoponDifferentialEquations -Finestructures arisinginreaction-diffusionequations (YoshihitoOshita) 2005-05-20 The7-thInternationalWorkshoponDifferentialEquations -Mountainpass solutions forsingularlyperturbednonlinearDirichletproblems (JaeyoungByeon) 2005-05-20 The7-thInternationalWorkshoponDifferentialEquations -Positiveentiresolutions ofsemilinearellipticequations withquadradicallydecay-ingcoefficient(SooHyunBae) 2005-05-20 The7-thInternationalWorkshoponDifferentialEquations -Mathematicalmodels onmultiphasetransitions (XinfuChen) 2005-05-20 The7-thInternationalWorkshoponDifferentialEquations -Uniqueness ofradiallysymmetricsolutions ofsemilinearellipticproblems inan-nulardomains (JaeduckJang) 2005-05-20 The7-thInternationalWorkshoponDifferentialEquations -Optimalbounds onthegradientofsolutions toconductivityproblems (HyeonbaeKang) 2005-05-20 The7-thInternationalWorkshoponDifferentialEquations -Magneticresonancecurrentdensityimagingforanelectricallyanisotropicsubject(JinKeunSeo) 2005-05-20 The7-thInternationalWorkshoponDifferentialEquations -EllipticNeumannboundaryvalueproblems onchemotaxis problems (WanSeKim) 2005-05-20 The7-thInternationalWorkshoponDifferentialEquations -Existenceandmultiplicityresults ofpositivesolutions forsingularboundaryvalueproblems viabifurcationmethods (YongHoonLee) 2005-05-20 2005 - (Batillus cornutus) ( ) 2005-05-20 2005 -GillUltrastructureoftheSpinyTopShell Batillus cornutus (Gastropoda:Turbinidae) (GwiGwonJung) 2005-05-20 2005 - (Batillus cornutus) ( ) 2005-05-20 2005 -MantleUltrasturctureandPeriostracumFormationoftheEquilateralVenus Gomphinaveneriformis (Bivalvia:Veneridae) (JungJunPark) 2005-05-20 2005 (Serioladumerili) ( ) 2005-05-20 2005 - (Scomberjaponicus) ( ) 2005-05-20 2005 -DistributionofCCK-IRcells inthedigestivetractoftheGobiidaefromJejuIsland Korea (SangWooHur SungJunKim YoungBoSong ChiHoonLee AkurangeHimaliInoshikaRanasinghe YoungDonLee) 2005-05-20 2005 (Siluriformes) ( ) 2005-05-20 2005 (Scomberomorus niphnius) ( ) 2005-05-20 2005 Tridentigerobscurus ( ) 2005-05-20 2005 -A SimpleScreeningMethodofAnti-attachmentCompounds usingPorphyrayezoensis Monospore (JS Choi SEKang SJ Yoon YP Gyawali MNA Khan SM Park YK Hong) 2005-05-20 2005 -Anti-inflammatoryactivityfrombrownseaweedIshigeokamurae (GyawaliYP KhanMNA ChoiJS KangSe YoonSJ ParkSM HongYK) 2005-05-20 2005 ( ) (M N A Khan Y P Gyawali ) 2005-05-20 2005 ( ) 2005-05-20 2005 -Growthandhematologicalchanges ofrockfish Sebates schlegeli(Hilgendorf)exposedtodietaryCuandCd (S G Kim Eom S S Kim H G Jin&J C Kang) 2005-05-20 2005 - Seriolaquinqueradiata ( ) 2005-05-20 2005 -( ) 2005-05-20 2005 ( ) 2005-05-20 2005 -AbnormalCoolingintheKoreanEasternSeaWaterBeforeandAfterthe1982/83andthe1997/98ENSO Events intheEast (ChulHoonHong SooEunPark) 2005-05-20 2005 a ( ) 2005-05-20 2005 -SystematicStudyofGenus PorphyraUsingITS ( ) 2005-05-20 2005 -RAPD ( ) 2005-05-20 2005 ( MasaoOhno ) 2005-05-20 2005 ( ) 2005-05-20 2005 -Linetransect ( ) 2005-05-20 2005 -NEMURO model ( ) 2005-05-20 2005 -2003-2004 ( ) 2005-05-20 2005 ( ) 2005-05-20 2005 ( ) 2005-05-20 2005 ( ) 2005-05-20 2005 ( ) 2005-05-20 2005 pleuromectes herzensteini II ( ) 2005-05-20 2005 (Todarodes pacificus) ( ) 2005-05-20 2005 Balaenopteraacutorostrata ( ) 2005-05-20 2005 -Impacts ofENSO onskipjacktuna(Katsuwonus pelamis)intheWesternCentralpacificOcean (EunJungKim SuAmKim DaeYeonMoon) 2005-05-20 2005 Portunus trituberculatus -1 -( ) 2005-05-20 2005 ( ) 2005-05-20 2005 - (Chelonhaenatohelia) EDCs ( ) 2005-05-20 2005 - Pagrus major ( ) 2005-05-20 The7-thInternationalWorkshoponDifferentialEquations -Onthedead-coreproblem(JongShenqGuo) 2005-05-19 The7-thInternationalWorkshoponDifferentialEquations -Decaybounds formagnetohydrodynamicgeophysicalflow (JongChulSong) 2005-05-19 The7-thInternationalWorkshoponDifferentialEquations -AsymptoticbehaviorofNavier-Stokes flow onanexteriordomain(Hyeong-OhkBae) 2005-05-19 The7-thInternationalWorkshoponDifferentialEquations -Travelingwaves ofmonostable/bistablecontinuum/discretemodels (XinfuChen) 2005-05-19 The7-thInternationalWorkshoponDifferentialEquations -TheRelationbetweensingularperturbationproblems andminimalpartitioningproblems (BongSooKo) 2005-05-19 Proceedings ofthe1stKAIST InternationalSymposium onEnhancingUniversityMathematics Teaching -A CAS-SupportedEnvironmentforLearningandTeachingCalculus (ElenaVarbanova) 2005-05-14 Proceedings ofthe1stKAIST InternationalSymposium onEnhancingUniversityMathematics Teaching -InteractiveGeometryandMultivariateCalculus ontheInternet(Thomas Banchoff) 2005-05-14 Proceedings ofthe1stKAIST InternationalSymposium onEnhancingUniversityMathematics Teaching -HelpingNew Mathematics FacultytoDevelopintoSuccessfulTeachers andScholars (ChristineStevens) 2005-05-14 Proceedings ofthe1stKAIST InternationalSymposium onEnhancingUniversityMathematics Teaching -UnderstandingandOvercomingStudentDifficulties withProofandProblemSolving(James Sandefur) 2005-05-14 Proceedings ofthe1stKAIST InternationalSymposium onEnhancingUniversityMathematics Teaching -ExperiencewithBlendedLearning:ITSupportInsidetheClassroomandBeyond(GabrieleUchida) 2005-05-14 Proceedings ofthe1stKAIST InternationalSymposium onEnhancingUniversityMathematics Teaching -Towards Inquiry-OrientedMathematics TeachinginUniversity(OhNamKwon) 2005-05-14 Proceedings ofthe1stKAIST InternationalSymposium onEnhancingUniversityMathematics Teaching -A LeverageinLearning(HuriyeArikan) 2005-05-14 Proceedings ofthe1stKAIST InternationalSymposium onEnhancingUniversityMathematics Teaching -Guidelines forUsingComputers CreativelyinMathematics Education(UlrichKortenkamp) 2005-05-14 Proceedings ofthe1stKAIST InternationalSymposium onEnhancingUniversityMathematics Teaching -CriticalIssues andInquiries RelatedtoEvolvingEducationalTechnologies (WarrenPage) 2005-05-14 Proceedings ofthe1stKAIST InternationalSymposium onEnhancingUniversityMathematics Teaching -MathematicalModelingandVisualizationwithMicrosoftExcel(DeaneArganbright ErichNeuwirth andRobertS Smith) 2005-05-14 Proceedings ofthe1stKAIST InternationalSymposium onEnhancingUniversityMathematics Teaching -A CurriculumforTeachingHow Mathematics is AppliedintheRealWorldinaTeacherEducationCourseinaJapaneseCollege(NaritaMasahiro) 2005-05-14 Proceedings ofthe1stKAIST InternationalSymposium onEnhancingUniversityMathematics Teaching -ComputerAlgebraandHumanAlgebra(WilliamMcCallum) 2005-05-13 Proceedings ofthe1stKAIST InternationalSymposium onEnhancingUniversityMathematics Teaching -A CAS-SupportedEnvironmentforLearningandTeachingCalculus (LeonH Seitelman) 2005-05-13 Proceedings ofthe1stKAIST InternationalSymposium onEnhancingUniversityMathematics Teaching -HarnessingtheEnthusiasmofOurBestandBrightestStudents forMathematics (DeborahHughes Hallett) 2005-05-13 Proceedings ofthe1stKAIST InternationalSymposium onEnhancingUniversityMathematics Teaching -Mathematics -AtYourService(TerryMills) 2005-05-13 Proceedings ofthe1stKAIST InternationalSymposium onEnhancingUniversityMathematics Teaching -ResearchExperiencewithUndergraduates (Chi-KwongLi) 2005-05-13 Proceedings ofthe1stKAIST InternationalSymposium onEnhancingUniversityMathematics Teaching -LearningEnvironmentofLinearAlgebrainKoreanColleges (Sang-GuLee) 2005-05-13 Proceedings ofthe1stKAIST InternationalSymposium onEnhancingUniversityMathematics Teaching -Computers SupportingMathematicalInsights -A CaseStudy(ErichNeuwirth) 2005-05-13 Proceedings ofthe1stKAIST InternationalSymposium onEnhancingUniversityMathematics Teaching -Spreadsheets intheMathematics Classroom(RobertS Smith) 2005-05-13 Proceedings ofthe1stKAIST InternationalSymposium onEnhancingUniversityMathematics Teaching -TeachingDevelopmentviaCaseStudies (SolomonFriedberg) 2005-05-13 Proceedings ofthe1stKAIST InternationalSymposium onEnhancingUniversityMathematics Teaching -IncorporatingMATLABintoUniversityMathematics Programs (AlexanderStanoyevitch) 2005-05-13 Proceedings ofthe1stKAIST InternationalSymposium onEnhancingUniversityMathematics Teaching -OnMathematics Courses fortheSocialSciences (Sung-OckKim) 2005-05-13 Proceedings ofthe1stKAIST InternationalSymposium onEnhancingUniversityMathematics Teaching -OnMathematicalContents ofComputerScienceContests (NikolayShilov) 2005-05-13 2005 ( ) 2005-05-12 2005 ( ) 2005-05-12 2005 ( ) 2005-05-12 2005 PAHs ( ) 2005-05-12 2005 PCBs ( ) 2005-05-12 2005 -Nano-S 1 ( ) 2005-05-12 2005 bioreactor ( TianYun ) 2005-05-12 2005 ( ) 2005-05-12 2005 -2004 2 ( ) 2005-05-12 2005 -2004 1 ( ) 2005-05-12 2005 ( ) 2005-05-12 2005 ( ) 2005-05-12 2005 (II) ( ) 2005-05-12 2005 ( ) 2005-05-12 2005 -MGIS GUI ( ) 2005-05-12 2005 ( TetsuoYanagi) 2005-05-12 2005 -Topex/Poseidon NOAA ( ) 2005-05-12 2005 -NOAA/AVHRR ( ) 2005-05-12 2005 EROD ( ) 2005-05-12 2005 -Estimationofdietaryintakeandhumanhealthriskofdioxins anddioxin-likecontaminants bytheconsumptionofmarineorganisms fromKoreancoastalwaters (HyoBangMoon SuJeongLee SangSooKim MinKyuChoi GuiYoungKimi JongSooPark) 2005-05-12 2005 ( ) 2005-05-12 2005 ( ) 2005-05-12 2005 ( ) 2005-05-12 2005 ( ) 2005-05-12 2005 ( ) 2005-05-12 2005 ( ) 2005-05-12 2005 ( ) 2005-05-12 2005 -DriectionalWave-riderBuoy ADCP ( ) 2005-05-12 2005 ( ) 2005-05-12 2005 ( ) 2005-05-12 2005 ( ) 2005-05-12 2005 ( ) 2005-05-12 2005 ( ) 2005-05-12 2005 -3 RANS ( ) 2005-05-12 2005 -k( ) 2005-05-12 2005 -HydrodynamicCharacteristics ofPressureImpulseonSeawaterExchangeBreakwater ( ) 2005-05-12 2005 ( ) 2005-05-12 2005 ( ) 2005-05-12 2005 ( ) 2005-05-12 2005 -A ComparisonofSeveralWaveSpectrafortheRandomwaveDiffractionbyaSemi-InfiniteBreakwater ( ) 2005-05-12 2005 ( ) 2005-05-12 2005 ( ) 2005-05-12 2005 -21 ( ) 2005-05-12 2005 MT ( ) 2005-05-12 2005 21 ( ) 2005-05-12 2005 ( ) 2005-05-12 2005 2 ( ) 2005-05-12 2005 -21 ( : ) ( ) 2005-05-12 -RemediationofU(VI)-contaminatedsoil:Biologialandchemicalmethods ( ) 2005-05-06 -Lakes oftheNorthAmericanPraires satellite-basedapproaches andwaterproblems dealingwithland-usechanges andnitratecontamination(Prof F W Schwartz) 2005-04-26 38 -Whatis Montmorillonite?( ) 2005-04-21 38 -Mobilityofbasemetalelements andrareearthelements duringthechemicalweatheringofvolcanicashsoilprofileinKantoarea centralJapan(NaotatsuShikazono) 2005-04-21 38 -Approachofaneconomicgeologistforsolvinglandcontaminationissues (KatsumiMarumo) 2005-04-21 38 -StudyonFundamentalEmissionCharacteristics ofTraceMetalCompounds andtheirControlinCombustionProcesses (IchiroNaruse) 2005-04-21 38 -TheJecheonGranite-A westernextensionoftheHidaGranites?(ShunsoIshihara) 2005-04-21 -Trace-metalbindingtomineralsurfaces andsoilorganicmatterPotentialadvantages inimmobilizationofmetalcontaminants ( ) 2005-04-04 AlgebraicGeometry-Number TheoryCamp -Ongeneralizations ofLagranges sumoffoursquares ( ) 2005-02-05 AlgebraicGeometry-Number TheoryCamp -Distributioninglobalfields ( ) 2005-02-05 AlgebraicGeometry-Number TheoryCamp -Syzygies andmultisecants toalgebraicvarieties ( ) 2005-02-05 AlgebraicGeometry-Number TheoryCamp -Rational uninational rationallyconnectedanduniruledvariaties ( ) 2005-02-05 AlgebraicGeometry-Number TheoryCamp -A local-globalprincipleforextensibilityofrepresentations ofquadraticforms andits applications ( ) 2005-02-04 AlgebraicGeometry-Number TheoryCamp -Circularunits ofabelianfields ( ) 2005-02-04 AlgebraicGeometry-Number TheoryCamp -Remarks onhyper-kahlergeometry( ) 2005-02-04 AlgebraicGeometry-Number TheoryCamp -Compactmoudlispaceofsurfaces ( ) 2005-02-04 AlgebraicGeometry-Number TheoryCamp -Exploringthesums ofpowers ofconsecutive$q$-integers ( ) 2005-02-03 AlgebraicGeometry-Number TheoryCamp -Class numbers ofthenumberfields ( ) 2005-02-03 AlgebraicGeometry-Number TheoryCamp -Linebundles onalgebraiccurves ( ) 2005-02-03 AlgebraicGeometry-Number TheoryCamp -Uniformboundedness oflevelstructures onabelianvarieties overcomplexfunctionfields (Hwang Jun-Muk) 2005-02-02 AlgebraicGeometry-Number TheoryCamp -Computationalmethods inalgebraicgeometry( ) 2005-02-02 AlgebraicGeometry-Number TheoryCamp -Galois groups andfundamentalgroups I( ) 2005-02-01 AlgebraicGeometry-Number TheoryCamp -Finitegroups actingonk3surfaces ( ) 2005-02-01 Backtotopofpage 2004 KSIAMAnnualMeetingandConference -Fluidmechanics :TheoryandApplications (Choi HiJun) 2004-12-04 KSIAMAnnualMeetingandConference -Mathematics ofFinanceandModernTheoryofFinance(Koo HyeongKeun) 2004-12-04 KSIAMAnnualMeetingandConference -Onthegenericsolvabilityforthe3D Navier-Stokes equations (Lee Jihoon) 2004-12-04 KSIAMAnnualMeetingandConference -Temporalandspatialdecayrateofsolutions ofNavier-Stokes equationinthehalfspace(Jin Bum-Ja) 2004-12-04 KSIAMAnnualMeetingandConference -Bifurcationproblems associatedwiththegeneralizedLaplacians (Sim Inbo) 2004-12-04 KSIAMAnnualMeetingandConference -Dynamics ofplasmaion-sheathinterface(Ha Seung-Yeal) 2004-12-04 KSIAMAnnualMeetingandConference -LargeNecessaryConditions forOptimalParameters inPerturbedSine-GordonEquations (Ha Junhong) 2004-12-04 KSIAMAnnualMeetingandConference -Bucklingbehaviors ofacirculararch(Go Jaegwi) 2004-12-04 KSIAMAnnualMeetingandConference -A DelayRecruitmentModeloftheCardiovascularControlSystem(McGuinness MarkJ ) 2004-12-04 KSIAMAnnualMeetingandConference -Three-DimensionalSimulations ofValveless Pumping(Jung Eunok) 2004-12-04 KSIAMAnnualMeetingandConference -O(N logn)algorithmforfindingprimarytandemrepeatinaDNA genomicsequence(Ma Sangback) 2004-12-04 KSIAMAnnualMeetingandConference -WeibullStatistics andTensileStrengthinContinuous Fiber-ReinforcedCeramicMatrixComposites (Cho Chongdu) 2004-12-04 KSIAMAnnualMeetingandConference -ApplicationoftheAutomaticDifferentiationtoAerodynamicDesignOptimization(Lee Jaehun) 2004-12-04 KSIAMAnnualMeetingandConference -A methodforincompressiblefreesurfaceflow includingsurfacetensionusingCSF model(Baek Jaeheon) 2004-12-04 KSIAMAnnualMeetingandConference -Analysis ofaOne-DimensionalFinUsingtheAnalyticMethodandtheFiniteDifferenceMethod(Han Youngmin) 2004-12-03 KSIAMAnnualMeetingandConference -EstimationofProbabilisticDistributionFunctionfortheResponses ofLinearSystems bySecond-OrderThirdMomentMethod(Kim Ki-Seok) 2004-12-03 KSIAMAnnualMeetingandConference -Identificationofdiscontinuous systemparameters intwo-dimensionalelasticcontinuausing$L^1$-regularizationfunctions (Park Seung-Keun) 2004-12-03 KSIAMAnnualMeetingandConference -SmoothcontactsurfacedetectionalgorithmusingNURBS (Ji Kuk-Hyun) 2004-12-03 KSIAMAnnualMeetingandConference -Optimizationofsatellitestructures usingRSM andSimulateAnnealing(Kim Jiyeon) 2004-12-03 KSIAMAnnualMeetingandConference -A HundredMillionDOFs FiniteElementAnalysis byDirectSolutionMethod(ParkSi-Hyoung) 2004-12-03 KSIAMAnnualMeetingandConference -AnAdaptiveNumericalInverseLaplaceTransformandits ApplicationtotheBlack-Scholes Equation(Ahn Jaemin) 2004-12-03 KSIAMAnnualMeetingandConference -Portfolioselectionwithtransactioncosts inadividend-payingasset(Jang Bong-Gyu) 2004-12-03 KSIAMAnnualMeetingandConference -SamplingTheoryinabstractreproducingkernelHilbertspace(Hong Yoonmi) 2004-12-03 KSIAMAnnualMeetingandConference -FinancialDerivatives withStochasticVolatility(Kim Jeong-Hoon) 2004-12-03 KSIAMAnnualMeetingandConference -Asymmetricmulti-channelsamplingandits aliasingerror(Kim Jongmin) 2004-12-03 KSIAMAnnualMeetingandConference -OptimalControlandSTIControlofTherapyinanHIV Model(Kwon Heedae) 2004-12-03 KSIAMAnnualMeetingandConference -OptimizationontheOrthogonalGroup:Theorems Algorithms andApplications (Park Chongwoo) 2004-12-03 ( ) 2004-11-09 2004 ( ) 2004-11-05 2004 Edwardsiellatarda ( ) 2004-11-05 2004 - (Gallarhois) ( ) 2004-11-05 2004 -Comparisons ofextracellularproducts (ECPs)fromStreptococcus iniaeisolates using20dimensionalgelelectrophoresis ( ) 2004-11-05 2004 -Edwardsiellatarda ( ) 2004-11-05 2004 ( ) 2004-11-05 2004 Mianiensus avidus ( ) 2004-11-05 2004 Miamiensis avidus Pseudocohnilembus persalinus P hargisi ( ) 2004-11-05 2004 -IdentificaitonandESTanalysis ofsucuticociliateisolatedfromJapaneseflounderparalichthys olivaceus (ShinIchiKitamura) 2004-11-05 2004 -IdentificaitonandESTanalysis ofsucuticociliateisolatedfromJapaneseflounderparalichthys olivaceus ( ) 2004-11-05 2004 ( ) 2004-11-05 2004 ( ) 2004-11-05 2004 ( ) 2004-11-05 2004 ( ) 2004-11-03 2004 -2004 5-6 ( ) 2004-11-03 2004 ( ) 2004-11-03 2004 ( ) 2004-11-03 2004 ( ) 2004-11-03 2004 ( ) 2004-11-03 2004 -SimulationofTidalFields aroundaHugeFloatingMarinaUsingaMulti-levelMethod (SungYounBoo) 2004-11-03 2004 ( ) 2004-11-03 2004 ( ) 2004-11-03 2004 ( ) 2004-11-03 2004 ( ) 2004-11-03 -Nashs BargainingTheory( ) 2004-10-28 -InterferometricSyntheticApertureRadar(InSAR)Studies ofVolcanoes andEarthquakes inAlaska(Dr ZhongLu) 2004-10-26 2004 - -( ) 2004-10-08 2004 ( ) 2004-10-08 2004 ( ) 2004-10-08 2004 ( ) 2004-10-08 2004 ( ) 2004-10-08 2004 ( ) 2004-10-08 AlgebraicGeometrySeminars -Highersecantvarieties andrelatedtopics II(FyodorZak) 2004-08-25 AlgebraicGeometrySeminars -Ondoublesolids ramifiedalongnodalsurfaces ( ) 2004-08-25 AlgebraicGeometrySeminars -Onacomputationofplurigenus ofcanonicalthreefolds ( ) 2004-08-25 AlgebraicGeometrySeminars -Highersecantvarieties andrelatedtopics I(FyodorZak) 2004-08-24 AlgebraicGeometrySeminars -Modulispaceofgenus 14is unirationalviaMacaulay2( ) 2004-08-24 AlgebraicGeometrySeminars -Onaquasicompleteintersection( ) 2004-08-24 InternationalWorkshoponDynamicalSystems andRelatedTopics -Daejeon2004 -Diffeomorphisms withlimitweakshadowing(KazuhiroSakai) 2004-08-00 InternationalWorkshoponDynamicalSystems andRelatedTopics -Daejeon2004 -Surmianwords \beta-shiftandtranscendence(DongPyoChi) 2004-08-00 InternationalWorkshoponDynamicalSystems andRelatedTopics -Daejeon2004 -Genericdynamics awayfromhomoclinicbifurcations (LanWen) 2004-08-00 InternationalWorkshoponDynamicalSystems andRelatedTopics -Daejeon2004 -Relativeentropyfunctions forfactormaps betweensubshifts (SujinShin) 2004-08-00 InternationalWorkshoponDynamicalSystems andRelatedTopics -Daejeon2004 -C^1-stablyexpansiveflows (KazumineMoriyasu) 2004-08-00 InternationalWorkshoponDynamicalSystems andRelatedTopics -Daejeon2004 -Shiftspaces withcountablestates andtheirC^*algebras (JaA Jeong) 2004-08-00 InternationalWorkshoponDynamicalSystems andRelatedTopics -Daejeon2004 -Theproblemofthefirsttangencyindynamicalsystems (YongluoCao) 2004-08-00 InternationalWorkshoponDynamicalSystems andRelatedTopics -Daejeon2004 -Largedeviationprincipleforsomeunimodalmaps (YongMooChung) 2004-08-00 InternationalWorkshoponDynamicalSystems andRelatedTopics -Daejeon2004 -Dynamics oftheg-Navier-Stokes equations (JaiokRoh) 2004-08-00 InternationalWorkshoponDynamicalSystems andRelatedTopics -Daejeon2004 -Complexityofadynamicalsystem:entropydimensions andsubgroupaction(KyewonKohPark) 2004-08-00 InternationalWorkshoponDynamicalSystems andRelatedTopics -Daejeon2004 -Substitutions onaninfinitealphabet:firstresults (SebastienFerenczi) 2004-08-00 InternationalWorkshoponDynamicalSystems andRelatedTopics -Daejeon2004 -PersistencepropertyofLyapunovexponentandentropyoncocycles (WenxiangSun) 2004-08-00 InternationalWorkshoponDynamicalSystems andRelatedTopics -Daejeon2004 -Reversals inSFTs (JungSeobLee) 2004-08-00 InternationalWorkshoponDynamicalSystems andRelatedTopics -Daejeon2004 -Dynamicequations ontimescales (SungKyuChoi) 2004-08-00 -Ramanujans Contributions toEisensteinseries especiallyinhis lostnotebook(BruceC Berndt) 2004-05-27 -EvolutionofResearchinHydrology:WhataretheNew Direction?(Prof FranklinW Schwarts) 2004-05-25 -Simulation-andCase-BasedAnalyses ofFlow andTransportProcesses inSurface/SubsurfaceEnvironments (Prof MotomuIbaraki) 2004-05-25 -InverseProblem:MEG ( )( ) 2004-05-21 10 ( ) 2004-05-10 10 ( ) 2004-05-10 10 ( ) 2004-05-10 10 ( ) 2004-05-10 10 ( ) 2004-05-10 10 YoungerDryas CoolingEvents ( ) 2004-05-10 10 ( ) 2004-05-10 -Applications ofCrredoxgeochemistry( ) 2004-05-04 9 ?( ) 2004-04-30 9 -Meanfieldtheories anddualvariation(TakashiSuzuki) 2004-04-30 9 ( )( ) 2004-04-30 ( ) 2004-04-29 -TheSmaleconjectureforlens spaces (SungbokHong) 2004-02-19 -Braidgroups thetopologyofconfigurationspaces andhomotopygroups (FrederickCohen) 2004-02-19 -4Minimalgenus problem(BangheLi) 2004-02-19 -Braids hypergeometricintegrals andconformalfieldtheory(ToshitakeKohno) 2004-02-18 -BraidColourings (PatrickDehornoy) 2004-02-18 -A variationofMcShanes identityforpuncturedsurfacebundles (MakotoSakuma) 2004-02-18 -Braids knots andcontactstructures on$\reals^3$(JoanBirman) 2004-02-17 -Concordanceofknots inrationalhomologyspheres (JaeChoonCha) 2004-02-17 -Braids andsingularbraids onsurfaces (Luis Paris) 2004-02-17 -4-dimensionalsurgeryona(YukioMatsumoto) 2004-02-17 Backtotopofpage 2003
2003 2003 2003 2003 2003 2003 2003 2003 2003 2003 2003 2003
2003 2003 2003 2003 2003 2003 2003 2003 2003 2003 2003 2003 2003 2003 2003 2003 2003 2003 2003 2003 2003 2003 2003 2003 2003 2003 2003 2003 2003 2003 2003 2003 2003 2003
( ) 2003-12-11 -Continent-continentcollisioninKoreanPeninsulaestimatedbyusingSatellitedata(CHAMP GRACE EGM96)(Dr Choi SungChan) 2003-11-26 -SignificantRoles ofMicrobes inpromotingthesmectite-to-illitetransformationandFlocculationproperties ( ) 2003-11-10 - ADCP ( ) 2003-11-06 -AnnualVariationofSeaSurfaceHeights across theTaiwanandKoreaStraits ( ) 2003-11-06 ( ) 2003-11-06 -SeasurfacecoolinginthesouthernareaoftheEastSeawiththepassageoftyphoons ( ) 2003-11-06 -Anobservationoftheabruptchanges intheEastSeaduringthepassageofthe2003typhoon MAEMI ( ) 2003-11-06 (2003 9) ( ) 2003-11-06 -TheresultofCTD observationinDrakePassageinNovember-December2001 ( ) 2003-11-06 -A TheoryfortheNearlyAnnualModeinthetropicalPacific ( ) 2003-11-06 -A NumericalInvestigationoftheRemoteInfluenceofPacificENSO onVariabilityintheTropicalAtlanticOcean ( ) 2003-11-06 -GlobalSSTPredictionSystematClimateEnvironmentSystemResearchCenter ( ) 2003-11-06 -Investigationoftheparticlesettlingprocess intheoceanmixedlayerusingLES ( ) 2003-11-06 -RecentSeaLevelRisingoftheEast/JapanSeawithPossibleInhomogeneous ResponsetoClimateChange ( ) 2003-11-06 -Waterwaveandweatherderivatives ( ) 2003-10-31 -StatisticalModels forSimulationErrors andtheirRoleinPredictionandUncertaintyQuantification(James Glimm) 2003-10-29 -StochasticPartialDifferentialEquations andApplications (James Glimm) 2003-10-27 -Two-PressureTwo-PhaseFlow Models (James Glimm) 2003-10-27 ( ) 2003-10-24 ( ) 2003-10-24 ( ) 2003-10-24 (I) ( ) 2003-10-24 ( ) 2003-10-24 (Hwang-JinRyu DoYoungKim) 2003-10-24 (Gyong-SeongLee Han-SamYoon Cheong-RoRyu Jong-HwaPark) 2003-10-24 -( ) 2003-10-24 -Waterfront ( ) 2003-10-24 WTP -( ) 2003-10-24 ( ) 2003-10-24 / VR ShipNavigationVR ( ) 2003-10-24 -BULK BallastWaterManagementPlan ( ) 2003-10-24 -DGPS ( ) 2003-10-24 -Ejector ( ) 2003-10-24 -ParvicapsulaanisocaudataZhao MaandSong 2003(Myxosporea:Parvicapsulidae)fromurinarysystemofculturedoliveflounder Paralichtys olivaceus (JaeBumCho KiHongKim) 2003-10-17 -BiologicalactivityofrecombinantIL-1inrainbow trout Oncorhyncus mykiss (SuheeHong Sang-JunLee Chris Secombes ) 2003-10-17 Oreochromis niloticus IL-1 ( ) 2003-10-17 - (Paralichthys olivaceus) phosphatidylcoline ( ) 2003-10-17 Edwardsiellatarda ( ) 2003-10-17 smallsubunitribosomalRNA gene Multiplex-PCR ( ) 2003-10-17 -Vibriosp tetgene ( ) 2003-10-17 Scapharcabroughtonii ( ) 2003-10-17 Turbot(Scophthalmus maximus) Iridovirus ( ) 2003-10-17 -2003 ( ) 2003-10-17 -2002 ( ) 2003-10-17 ( ) 2003-10-17 (phosphorus) alkalinephosphatasehydrolyzablephosphorus ( TamijiYamamoto YukihikoMatsuyaman ShigeruItakura SatoshiNagai ) 2003-10-17 ( ) 2003-10-17 ( ) 2003-10-17 ( ) 2003-10-17 ( ) 2003-10-17 ( ) 2003-10-17 -SeaSurfaceCoolingintheSouthernAreaoftheEastSeawiththePassageofTyphoons (Chul-HoonHon Ik-SungSohn) 2003-10-17 -MotivicChohomology log ( ) 2003-10-16 -Hermitianvectorbundles (VincentMaillot) 2003-10-09 -Rigidanalyticspaces andcohomology(5)(RalfGerkmann) 2003-10-09 -Arithmeticintersectiontheory(VincentMaillot) 2003-10-08 -Rigidanalyticspaces andcohomology(4)(RalfGerkmann) 2003-10-08 -Rigidanalyticspaces andcohomology(3)(RalfGerkmann) 2003-10-07 -IntroductiontoArakelovgeometry(VincentMaillot) 2003-10-06 -Rigidanalyticspaces andcohomology(2)(RalfGerkmann) 2003-10-06 -Rigidanalyticspaces andcohomology(1)(RalfGerkmann) 2003-10-02 -MultimediainDigitalSpace( ) 2003-09-17 -Gas Isotopes:A New ToolforStudyingBiogeochemicalProcesses intheSubsurface(Dr LeeEungSeok) 2003-09-04 -MicrobialReductionofIronandOtherMetals:Geochemical EnvironmentalandBiotechnologicalImplications-A ( ) 2003-06-26 -MicrobialReductionofIronandOtherMetals:Geochemical EnvironmentalandBiotechnologicalImplications-B( ) 2003-06-26 ( ) 2003-06-13 -LocalTomographyandImageProcessing(AlexanderG Ramm) 2003-06-13 -InverseProblems 3(AlexanderG Ramm) 2003-06-12 -InverseProblems 2(AlexanderG Ramm) 2003-06-10 -StableNumericalDifferentiationandDeconvolution(AlexanderG Ramm) 2003-06-10 -InverseProblems 1(AlexanderG Ramm) 2003-06-05 -ModifiedRayleighConjecture(AlexanderG Ramm) 2003-06-03 -Sequestrationofradionuclides duringclaymineralweatheringathighpH -A ( ) 2003-05-28 -Sequestrationofradionuclides duringclaymineralweatheringathighpH -B( ) 2003-05-28 -DSM(DynamicalSystems Method)(AlexanderG Ramm) 2003-05-27 -EnvironmentalConditions andHabitats oftheGermanWaddenSea(Dr Carl-HeinzvanBernem) 2003-04-08 -Monitoringoftidalflatusingairbornevideosystems (Dr RolandDoerffer) 2003-04-08 -CharacterizationofSubsurfaceHeterogeneity:3D CoupledMarkovChainModel(Dr ParkEunGyu) 2003-01-03 -TraceElements inEnvironmentalandHumanHealth-B(Prof D C Adriano) 2002-09-03 Backtotopofpage
2002 -Semi-passive chemicaloxidationschemes forthelong-termtreatmentofcontaminants (Dr Lee EungSeok) 2002-12-16 -InvarianceandNumberTheory( ) 2002-12-12 -ElementarySurveyofBio-Informatics ( ) 2002-11-28 ( )( ) 2002-11-07 -Onaclass ofVolterraintegraloperators (VladimirD Stepanov) 2002-10-10 -TraceElements inEnvironmentalandHumanHealth-A (Prof D C Adriano) 2002-09-03 -DeterministicandProbabilisticAnalysis ofRockSlopeStabilityunderEarthquakeLoadingConditions ( ) 2002-07-11 Multiplier ideals theoryandits applications -Constructionofasymptoticmultiplierideals (Jun-MukHwang) 2002-06-27 Multiplier ideals theoryandits applications -Properties ofasymptoticmultiplierideals (Seung-HunLee) 2002-06-27 Multiplier ideals theoryandits applications -Multiplicavityofplurigenera volumeofbigdivisors (Jun-MukHwang) 2002-06-27 Multiplier ideals theoryandits applications -Surveyofresults onFujitaconjectureandotherapplications ofmultiplierideals (Seung-HunLee) 2002-06-27 Multiplier ideals theoryandits applications -Families andcoverings (Jun-MukHwang) 2002-06-25 Multiplier ideals theoryandits applications -Singularities ofhypersurfaces andthetadivisors separationaofjets ofadjointseries (Seung-HunLee) 2002-06-25 Multiplier ideals theoryandits applications -Q-divisors logresolutions definitions andfirstproperties ofmultiplieridealsheaves (Jun-MukHwang) 2002-06-24 Multiplier ideals theoryandits applications -Multiplierideals andmultiplicity invariants monomialideals (Seung-HunLee) 2002-06-24 Multiplier ideals theoryandits applications -Vanishingtheorems (Jun-MukHwang) 2002-06-24 Multiplier ideals theoryandits applications -Restriction subadditivity andthesummationtheorem(Seung-HunLee) 2002-06-24 -MagnetostratigraphyofQuaternarysediments basedonpaleomagneticsecularvariation(Prof AkiraHayashida) 2002-06-22 -Activetectonics andbasinformationintheOsakaSedimentaryBasin southwestJapan(Prof KeijiTAKEMURA) 2002-06-22 BK21ShortCourseSeries4-PALEOSESMOLOGY -PaleoseismologyandpaleogeodesyoftheSumatransubductionzone(Prof KerrySieh) 2002-06-05 BK21ShortCourseSeries4-PALEOSESMOLOGY -Paleoseismicevidencefortherepetitionoflargefaultruptures (Prof KerrySieh) 2002-06-05 -Preliminarypaleoseismicandneotectonicstudies inTiwan(Prof KerrySieh) 2002-06-05 BK21ShortCourseSeries4-PALEOSESMOLOGY -Introductiontopaleoseismology(Prof KerrySieh) 2002-06-05 35 ( ) 2002-04-26 35 -SoilMineralogy:RecentDiscoveries andTheirImplications (Prof JoeB Dixon) 2002-04-26 Colloquium -QuantumAffineAlgebras CrystalBases andLEGO-Tetris ( ) 2002-03-15 -CarbonandWaterCycles intheMississippiRiverBasin:Implications fortheNorthernHemisphereTerrestrialSink( ) 2002-01-17 Backtotopofpage 2001 -LowerDimensionalRepretationofTextDatainVectorSpaceBasedInformationRetrieval( ) 2001-11-16 -Sorptionmechanisms ofSrandPbonzeolitizedtuffs fromtheNevadaTestSiteusingX-rayAbsorptionSpectroscopy(XAS)andX-rayPhotoelectronSpectroscopy(XPS)( ( ) 2001-10-23 -TheVerticalElectricCylinder(Mr PierreFRAPPIN) 2001-10-11 -EnvironmentalGeochemistryattheGlobalScale(Prof JanePlant) 2001-09-21 -Groundwatervulnerabilityandaquiferprotection(Dr BrianLMorris) 2001-09-20
) 2001-10-24
Backtotopofpage 2000 Colloquium -EntropyBoltzmanSamplings inGeneticAlgorithm( ) 2000-12-22 Colloquium -Dehnsurgeryandunknottingtunnels (HiroshiGoda) 2000-12-19 Colloquium -HurwitzClassificationTheoremforBranchedSurfaceCoverings andRelatedEnumerationProblems ( ) 2000-12-13 Colloquium -Periodthreeimplies allknots (JeromeLos) 2000-12-00 KOREAandJAPANJOINT WORKSHOPinMATHEMATICS -Sufficientconditions forconstantmeancurvaturesurfaces toberound(JaigyoungChoe) 2000-11-09 KOREAandJAPANJOINT WORKSHOPinMATHEMATICS -WeierstrabetaBryantformulaofsuperminimalJ holomorphiccurves ofa6dimensionalsphere(HideyaHashimoto) 2000-11-09 KOREAandJAPANJOINT WORKSHOPinMATHEMATICS -Geometryoforbits ofisotropygroups (OsamuIkawa) 2000-11-09 KOREAandJAPANJOINT WORKSHOPinMATHEMATICS -DeformationrigidityofG/P (Jun-MukHwang) 2000-11-08 KOREAandJAPANJOINT WORKSHOPinMATHEMATICS -Manifolds whicharenotconformaltosubdomains ofacompactmanifold(Sung-EunKoh) 2000-11-08 KOREAandJAPANJOINT WORKSHOPinMATHEMATICS -Finslermetrics onsymmetriccones (YongdoLim) 2000-11-08 KOREAandJAPANJOINT WORKSHOPinMATHEMATICS -Submanifolds withdegenerateGauss map(ReikoMiyaoka) 2000-11-08 KOREAandJAPANJOINT WORKSHOPinMATHEMATICS -Somedifferentialgeometricproperties ofRspaces (HyunjungSong) 2000-11-08 KOREAandJAPANJOINT WORKSHOPinMATHEMATICS -K$\ddot{a}$hlermagneticfields onacomplexhyperbolicspace(ToshiakiAdachi) 2000-11-07 KOREAandJAPANJOINT WORKSHOPinMATHEMATICS -Realprojectivestructures on2orbifolds andTeichmullercomponents (SuhyoungChoi) 2000-11-07 KOREAandJAPANJOINT WORKSHOPinMATHEMATICS -Ontherigidityofsymmetricspaces andapplications (In-KangKim) 2000-11-07 KOREAandJAPANJOINT WORKSHOPinMATHEMATICS -SpecialLagrangiansubmanifolds andholomorphicvolumepreservingmaps (Yong-GeunOh) 2000-11-07 KOREAandJAPANJOINT WORKSHOPinMATHEMATICS -ObstructiontheorytoanddeformationtheoryofLagrangianintersectionFloercohomology(HiroshiOhta) 2000-11-07 KOREAandJAPANJOINT WORKSHOPinMATHEMATICS -Simplesingularities andsymplecticfillings (KaoruOno) 2000-11-07 Colloquium -Class numberoneproblem( ) 2000-10-27 Colloquium -Wildpcycleactions onK_3Surfaces ( ) 2000-10-06 AlgebraicGeometryWorkshop -Pluricanonicalsystems ofvarieties ofgeneraltype(H Tsuji) 2000-09-29 AlgebraicGeometryWorkshop -Ontheisotrivialityofmorphisms toprojectivecurves (E Viehweg) 2000-09-29 AlgebraicGeometryWorkshop -Onbasepointfreeargument(Y Kawamata) 2000-09-28 AlgebraicGeometryWorkshop -Wildpcyclicactions onsurfaces withp_g= q= 0(JonghaeKeum) 2000-09-28 AlgebraicGeometryWorkshop -ThemoduliofEnriques surfaces andBorcherds products (S Kondo) 2000-09-28 AlgebraicGeometryWorkshop -Remarkonthreefolds inP^5ofcongruenceoforderzeroandaquadruplepointformulahttp://www mathnetorkr/new_sub04/sub04_01_01php? no=2206&ko_name=%EA%B3%BD%EC%8B%9C%EC%A2%85&paper_id=&key_name=%EA%B3%BD%EC%8B%9C%EC%A2%85&key_locale=in(Kwak Sijong) 2000-09-28 AlgebraicGeometryWorkshop -Bounds andQ Gorensteinsmoothings ofsmoothablestablesurfaces (YongnamLee) 2000-09-28 AlgebraicGeometryWorkshop -Thesimplegroupoforder168andK3surfaces (K Oguiso) 2000-09-28 AlgebraicGeometryWorkshop -Localsimpleconnectedness ofresolutionoflogterminalsingularities (S Takayama) 2000-09-28 AlgebraicGeometryWorkshop -Remarks onthedefiningequations ofsmooththreefolds inP^5(YoungookChoi) 2000-09-27 AlgebraicGeometryWorkshop -Realhyperellipticsurfaces andtheorbifoldfundamentalgroup(F Catanese) 2000-09-27 AlgebraicGeometryWorkshop -A localinvariantofasingularityofaconnectiononcurves:definition properties andconjecture(H Esnault) 2000-09-27 AlgebraicGeometryWorkshop -Smoothvarieties dominatedbyabelianvarieties (Jun-MukHwang) 2000-09-27 AlgebraicGeometryWorkshop -Unprojectionandbirationalgeometry(M Reid) 2000-09-27 AlgebraicGeometryWorkshop -Onthedegreeofdualvarieties (F Zak) 2000-09-27 Colloquium -Knots DerivedfromSym(2 R)( ) 2000-06-21 Four DimensionalManifolds Workshop -Symplecticsurfaces inagivenhomologyclass (RonFintushel) 2000-06-05 Four DimensionalManifolds Workshop -SymplecticTopology(BobGompf) 2000-06-05 Four DimensionalManifolds Workshop -TopologicalCharacterizingSymplecticManifolds (BobGompf) 2000-06-05 Four DimensionalManifolds Workshop -AntiholomerphicTwisterandSymplecticStructure(DosangJoe) 2000-06-05 Four DimensionalManifolds Workshop -SeibergWittenTheorywithSpinQ Structure(InkangKim) 2000-06-05 Four DimensionalManifolds Workshop -Themanyfaces ofFloerhomology(PeterOzsvath) 2000-06-05 Four DimensionalManifolds Workshop -Holomorphicdisks andthreemanifoldinvariants (PeterOzsvath) 2000-06-05 Four DimensionalManifolds Workshop -TheGeographyofSpinSymplectic4Manifolds (JongilPark) 2000-06-05 Four DimensionalManifolds Workshop -Lefschetzfibrations:properties andapplications (Andras Stipsicz) 2000-06-05 SymplecticGeometryandMirror Symmetry -Estimatedtransversalityinsymplecticgeometryandprojectivemaps (D Auroux) 2000-06-05 SymplecticGeometryandMirror Symmetry -Localmirrorsymmetryandsupersymmetricgaugetheories (T Eguchi) 2000-06-05 SymplecticGeometryandMirror Symmetry -Highergenus Frobenius manifolds (E Getzler) 2000-06-05 SymplecticGeometryandMirror Symmetry -SemisimpleFrobenius structures athighergenus (A Givental) 2000-06-05 SymplecticGeometryandMirror Symmetry -MirrorSymmetryforClosedandOpenStrings (K Hori) 2000-06-05 SymplecticGeometryandMirror Symmetry -LargeComplexStructureLimits ofK3surfaces (M Gross) 2000-06-05 SymplecticGeometryandMirror Symmetry -Relations inthemodulispaceofstablecurves (E Ionel) 2000-06-05 SymplecticGeometryandMirror Symmetry -Theconnectedness ofthemodulispaceofmaps tohomogeneous spaces (BumsigKim) 2000-06-05 SymplecticGeometryandMirror Symmetry -TheVirasoroconjectureforGromovWitteninvariants (XiaoboLiu) 2000-06-05 SymplecticGeometryandMirror Symmetry -Quantumhomologyandsymplecticfiberbundles (D McDuff) 2000-06-05 SymplecticGeometryandMirror Symmetry -OnMcKaycorrespondence(H Nakajima) 2000-06-05 SymplecticGeometryandMirror Symmetry -Integers intheGromovWittentheoryof3folds (R Pandharipande) 2000-06-05 SymplecticGeometryandMirror Symmetry -StringandDeformationTheory(JaesukPark) 2000-06-05 SymplecticGeometryandMirror Symmetry -Lagrangiantorus fibrationofCalabiYaumanifoldandmirrorsymmetry(Wei-DongRuan) 2000-06-05 SymplecticGeometryandMirror Symmetry -Vanishingcycles andmutations (P Seidel) 2000-06-05 SymplecticGeometryandMirror Symmetry -Momentmaps monodromyandmirrormanifolds (R Thomas) 2000-06-05 Colloquium -ProblemReductiontoParameterSpace( ) 2000-05-31 Colloquium -Radontransforms andconvolutionoperators ( ) 2000-05-10 -How tosimplifysingularities ofsmoothmappings (Eliashberg) 2000-05-03 -Invariants ofcontactdomains andnonsqueezingresults incontactgeometry(Eliashberg) 2000-05-02 -Classificationofvectorbundles overcircles andspheres withgroupactions ( ) 2000-05-01 Colloquium -OnFinancialDerivatives ( ) 2000-04-19 Colloquium -Octanions ( ) 2000-03-29 Colloquium -MorsetheoryandLagrangianintersectiontheory( ) 2000-03-29 Colloquium ofDepartmentofMathematicalSciences KAIST -CartanFubinitypeextensionofholomorphicmaps (Hwang Jun-Muk) 2000-03-29
Back to top of page